KEGG   Seohaeicola sp. tig00000074: ACMUJL_17500
Entry
ACMUJL_17500      CDS       T11112                                 
Symbol
tldD
Name
(GenBank) metalloprotease TldD
  KO
K03568  TldD protein
Organism
seoh  Seohaeicola sp. tig00000074
Brite
KEGG Orthology (KO) [BR:seoh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:seoh01002]
    ACMUJL_17500 (tldD)
Peptidases and inhibitors [BR:seoh01002]
 Peptidases of unknown catalytic type
  Family U62
   ACMUJL_17500 (tldD)
SSDB
Motif
Pfam: PmbA_TldD_3rd PmbA_TldD_2nd PmbA_TldD_1st
Other DBs
NCBI-ProteinID: XOY39701
LinkDB
Position
complement(3528858..3530279)
AA seq 473 aa
MSDMEFRPLDDRISPETALALLREATAGADDGELFFERRRSEALVFDDGRVKTASYDASE
GFGLRAVRGEVTGYAHSSEISEAALRRAMGTARLAVGDGGGTWAEAPRATNRRLYTDADP
IAGVSFPVKLETLREIDAFARSLDSRVVQVSATIAASIQEVEILRPDGVHLRDVRPMTRV
NVSVIVDQDGRRESGSAGGGGRVGLDGLLDPADWQAKTREALRIATVNLEAVPAPAGVMD
VVLGPGWPGILLHEAIGHGLEGDFNRKGTSAFAGLMGQQIAARGVTVLDDGTIPDRRGSI
SIDDEGTPSGKTTLIEDGVLVGYMQDRQNARLMGVAATGNGRRESYAHAPMPRMTNTYML
GGDTDPADIVADLRDGIYAVGFGGGQVDITNGKFVFSCTEAYRVQNGKIGAPVKGATLIG
DGATALKKIRAIGNDMALDPGMGNCGKAGQWVPVGVGQPTLMIGGLTVGGSAA
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgtccgatatggaattccgccccctcgacgatcgaatctcccctgaaaccgcgctggcg
ctgctgcgcgaggccacggcgggcgccgatgacggagagcttttcttcgagcggcgccgg
tccgaagcgctggtctttgacgatggccgggtgaaaaccgccagctatgatgcctccgaa
ggcttcggtctgcgcgccgtgcgcggcgaggtgacgggctacgcgcattcctcggaaatc
tcggaagcggcgctgcgccgcgcgatgggcacggcacggctggccgtgggcgatggcggc
ggcacctgggccgaggcgccgcgcgccaccaatcgccgcctttatacggatgccgatccg
atcgcgggtgtcagctttccggtcaagctggagaccctgcgcgagatcgacgccttcgca
cgcagccttgacagccgcgtggtgcaggtcagcgcgaccatcgcggcctcgatccaggag
gtcgagatcctgcgccccgacggggtgcacctgcgcgacgtgcgcccgatgacccgcgtc
aatgtcagcgtgatcgtggaccaggacgggcggcgcgaaagcggctcggcgggcggcggc
gggcgcgtggggctggacgggctgcttgatcccgccgactggcaggccaagacccgcgag
gcgctgcgcatcgccaccgtcaacctcgaggcggtccccgcccccgcgggcgtgatggat
gtggtccttggccccggctggcccggcatcctgctgcacgaggcgatcgggcacggactt
gagggcgatttcaaccgcaagggcacatccgcctttgccgggctcatggggcagcagatc
gcggcgcgcggcgtgaccgttctggatgatggcaccattcccgatcggcgcggctcgatc
agcatcgatgacgaaggcacgccctcgggcaagaccacgctgatcgaggatggcgtgctg
gtgggctacatgcaggatcgtcagaacgcgcgcctgatgggcgtggccgccaccggcaac
ggccggcgcgaaagctatgcccatgcgccgatgccgcgcatgaccaacacctacatgctg
ggcggcgacaccgatcccgccgatatcgtggcggacctcagggacgggatctatgcggtg
ggcttcggcggcgggcaggtcgacatcaccaatggcaagttcgtcttcagctgcaccgag
gcataccgcgtccagaacggcaagatcggcgcgcctgtcaaaggcgccacgctgatcggc
gacggcgcgaccgccctcaagaagatccgcgccatcggcaatgacatggcccttgatccc
ggcatgggcaattgcggcaaggccgggcaatgggtgcccgtgggcgtgggccagcccacg
ctgatgatcggcgggctgaccgttggcggctcggccgcctga

DBGET integrated database retrieval system