Staphylococcus epidermidis ATCC 12228: SE_0907 Help Entry SE_0907           CDS       T00110                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sep  Staphylococcus epidermidis ATCC 12228 Pathway sep01100   Metabolic pathways sep01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sep00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SE_0907    00074 Mycolic acid biosynthesis     SE_0907   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SE_0907 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L50 Ribosomal_L12_N HLH Motif Other DBs NCBI-ProteinID:  AAO04504 UniProt:  Q8CPI2 LinkDB All DBs Position 904173..904406 Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDADKVTEDASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE KINTVGDAVKYINSLEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggaaaacttcgataaagtaaaagacatcatcgttgatcgtttaggcgtagatgctgat aaggtaacagaagacgcatcattcaaagatgatttaggcgctgactcacttgatatcgct gaattagtaatggaattagaagacgaatttggtactgaaattcctgatgaagaagcagaa aaaatcaacactgttggtgatgctgttaaatacatcaacagccttgaaaaataa

DBGET integrated database retrieval system