Staphylococcus epidermidis RP62A (MRSE): SERP0798 Help Entry SERP0798          CDS       T00229                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ser  Staphylococcus epidermidis RP62A (MRSE) Pathway ser01100   Metabolic pathways ser01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ser00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SERP0798 (acpP)    00074 Mycolic acid biosynthesis     SERP0798 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SERP0798 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 Ribosomal_L12_N HLH Motif Other DBs NCBI-ProteinID:  AAW54129 UniProt:  Q5HPV9 LinkDB All DBs Position 798242..798475 Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDADKVTEDASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE KINTVGDAVKYINSLEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggaaaacttcgataaagtaaaagacatcatcgttgatcgtttaggcgtagatgctgac aaggtaactgaagacgcatcattcaaagatgatttaggcgctgactcacttgatatcgct gaattagtaatggaattagaagacgaatttggtactgaaattcctgatgaagaagcagaa aaaatcaacactgttggtgatgctgttaaatacatcaacagccttgaaaaataa

DBGET integrated database retrieval system