KEGG   Serratia sp. HRI: GF111_18880
Entry
GF111_18880       CDS       T10951                                 
Symbol
glrR
Name
(GenBank) two-component system response regulator GlrR
  KO
K07715  two-component system, NtrC family, response regulator GlrR
Organism
serh  Serratia sp. HRI
Pathway
serh02020  Two-component system
serh02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:serh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GF111_18880 (glrR)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GF111_18880 (glrR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:serh02022]
    GF111_18880 (glrR)
Two-component system [BR:serh02022]
 NtrC family
  GlrK-GlrR (amino sugar metabolism)
   GF111_18880 (glrR)
SSDB
Motif
Pfam: Sigma54_activat Response_reg Sigma54_activ_2 AAA_5 AAA_16 HTH_8 AAA AAA_2 UPF0175 AAA_3 PDE8A_N AAA_7 OKR_DC_1_N AAA_30
Other DBs
NCBI-ProteinID: UBI62908
LinkDB
Position
3937578..3938918
AA seq 446 aa
MTARKPANLLLVDDDPSLLKLLGMRLTSEGFHVTTAESGQEALRLLAREQIDLVISDLRM
DEMDGMALFAEIQKHQPGMPVIILTAHGSIPDAVAATQQGVFSFLTKPVDRDALYKAIDE
ALALSATPAGDEAWREDIVTRSPLMLRLLEQVKMVAQSDVSVLINGQSGTGKEVVAQAIH
AASPRAGKAFIAINCGALPEQLLESELFGHAKGAFTGAVSSREGLFQAAAGGTLFLDEIG
DMPLSLQVKLLRVLQERKVRPLGSNRDLDIDVRIISATHRDLQKAMAKNEFREDLYYRLN
VVNLKIPALNERAEDIPLLANHLLREAAQRHKPFVRSFSTDAMKRLMTASWPGNVRQLVN
VIEQCVALTSAPVISEALVEQALEGENTALPTFAEARNQFELHYLRKLLQITKGNVTQAA
RMAGRNRTEFYKLLSRHELDANDFKE
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgaccgcacgcaaaccggccaatttgctcttggttgacgacgatcccagcctgctgaag
ctgctgggcatgcgtctgaccagcgaaggttttcacgtcaccaccgccgaaagcggccag
gaagcgctgcgcctgctggcgcgcgaacagatcgatctggtgatcagcgatctgcgtatg
gacgagatggacggcatggcgctgttcgccgagatccaaaagcatcagccgggcatgccg
gtgatcatcctcaccgcgcacggttcgattcccgatgcggtggccgccacccagcagggg
gtgttcagcttcctcaccaaaccggtggatcgcgatgcgctgtataaggccatcgacgag
gcgctcgcgctgtcggccaccccggccggcgacgaggcctggcgcgaagacatcgtcacc
cgcagcccgctgatgctgcgcctgctggagcaggtgaaaatggtggcgcagtccgacgtc
agcgtcttgatcaacggccagagcggcaccggtaaagaggtggtggcgcaggcgatccac
gcggccagcccgcgcgccggcaaggcgttcatcgccatcaactgcggcgcgctgccggag
cagctgctggagtccgaactgttcggccatgccaagggcgcctttaccggcgcggtcagc
agccgcgaagggctgttccaggcggcagcgggcggcacgctgttcctcgacgagatcggc
gatatgccgctgtcgctgcaggtgaagttgctgcgcgtgctgcaagagcgcaaggtgcgg
ccgctgggcagcaaccgcgatctggacattgacgtgcgcatcatctccgccacccaccgc
gatctgcaaaaggcgatggcgaagaacgagttccgcgaggatctctactaccgcctcaac
gtggtgaacctgaagatcccggcgctcaacgaacgcgccgaagatatcccgctattggcc
aatcacctgttgcgcgaagcggctcagcggcacaagccgttcgtgcgcagcttctcgacc
gacgccatgaagcggctgatgaccgccagctggccgggcaacgtgcgtcagctggtcaac
gtcatcgagcagtgcgtggcgctgacttcggcaccggtgatcagcgaagcgctggtggag
caggcgctggaaggggaaaacaccgcgctgccgaccttcgccgaagcgcgcaaccagttc
gagttgcactacctgcgcaagctgctgcagatcaccaagggcaacgtgacccaggccgcg
cgcatggcgggccgcaaccgcaccgagttttacaaattgctgtcgcgccacgaactggac
gccaacgattttaaagaatga

DBGET integrated database retrieval system