Serratia sp. MYb239: CLM71_04150 Help Entry CLM71_04150       CDS       T05477                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism serm  Serratia sp. MYb239 Pathway serm01100   Metabolic pathways serm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:serm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CLM71_04150    00074 Mycolic acid biosynthesis     CLM71_04150   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CLM71_04150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AVJ16378 LinkDB All DBs Position 888885..889145 Genome browser AA seq 86 aa AA seqDB search MHLLSTEIKQLIIDSLNLEGMTPDEIDTQAPLFGEGLGLDSIDALELGLALKNRYGVVLS AESDDMRQHFYSVETLAAFVSAQRSK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcatttattgagcaccgaaatcaagcaattgattattgattcgctcaatcttgaaggc atgacgccggatgagattgacacacaggcgcctttgttcggcgaaggattaggactggat tccattgatgcgttggaattggggctggcgttgaaaaaccgctatggcgttgtgctgtcg gccgaaagcgacgatatgcgtcagcatttttattctgtggaaacgttggccgcgtttgtt tccgcacagcgtagcaaataa

DBGET integrated database retrieval system