KEGG   Serratia sp. MYb239: CLM71_22065
Entry
CLM71_22065       CDS       T05477                                 
Name
(GenBank) taurine dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
serm  Serratia sp. MYb239
Pathway
serm00430  Taurine and hypotaurine metabolism
serm00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:serm00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    CLM71_22065
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CLM71_22065
Enzymes [BR:serm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     CLM71_22065
SSDB
Motif
Pfam: TauD XPC-binding CaATP_NAI
Other DBs
NCBI-ProteinID: AVJ19639
LinkDB
Position
complement(4617064..4617912)
AA seq 282 aa
MNERLVITPLGPYIGALVENVQLARPLGDGQFEQLYHALLKHQVLFFRNQPITPLQQRDL
AGRFGDLHIHPVYPHASDVEEIIVLDTHDNNPPDNDNWHTDVTFIENPPLGAILAAKTLP
ATGGDTLWASGIAAYEALSAPFKQLLSGLQAEHDFTKSFPEYKHRGSEEEHQRWRQAVQK
NPPLLHPVIRTHPVSGRQALFVNEGFTTRIVDVSPKESEALLGFLFAHITKPEFQVRWRW
QENDIAIWDNRVTQHYANADYLPQRRIMHRATMLGDKPFYRA
NT seq 849 nt   +upstreamnt  +downstreamnt
atgaacgaacgtctggtgattaccccgttagggccgtatatcggcgcgctggtggaaaat
gtgcagctggcgcggccgctgggtgacggacagtttgagcagctgtatcacgcgctgctg
aaacatcaggtgctgtttttccgcaatcagccgattacgccgctgcagcagcgcgatctg
gcgggacgcttcggcgacctgcatattcacccggtgtatccgcacgccagcgacgtggag
gaaattatcgtgctggatacccacgataataatccgccggacaacgataactggcacacc
gatgtcacctttatcgaaaatccgccgctgggagcgatcctggcggcgaaaacgctgccg
gccaccggcggcgataccctgtgggccagcggcattgccgcctatgaggcgctgtcggca
ccgttcaagcaactgctgagcggtctgcaggcggagcacgacttcaccaagtcattcccg
gaatataaacatcgcggcagcgaggaggaacaccagcgctggcgacaggcggtgcagaaa
aatccgccgctgctgcatccggtgatccgtacccacccggtaagcggccggcaggcgctg
ttcgtcaatgaaggctttaccacgcggattgtcgatgtgtcgccgaaagagagcgaggcg
ctgctgggcttcctgtttgctcatatcaccaaaccggagttccaggtgcgctggcgctgg
caggaaaatgatattgccatctgggacaaccgcgtgacgcagcattacgccaacgcggat
tatttgccgcagcgccgtattatgcaccgggcgacgatgttgggtgataagccgttttac
cgcgcctga

DBGET integrated database retrieval system