Serratia sp. NGAS9: GUC32_21770 Help Entry GUC32_21770       CDS       T10949                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sern  Serratia sp. NGAS9 Pathway sern01100   Metabolic pathways sern01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sern00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GUC32_21770    00074 Mycolic acid biosynthesis     GUC32_21770   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GUC32_21770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QHI80068 UniProt:  A0AAX1GD09 LinkDB All DBs Position complement(4589872..4590129) Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIIDTLNLEELTADDIETQAALFGEGLGLDSIDALELGLAVKNKYGIVLS AESEEMRQHFYSVATLASFIHSQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctttatctagaaattaaaaatctcattattgatacattgaatttggaggag ctgacggcggatgatattgaaacgcaggcggctctgttcggggaaggattaggactggac tccatcgatgcgcttgaactcgggctggcggtaaaaaataagtacggcatcgtgctttcc gccgaaagtgaagaaatgcgccagcacttttactctgtagcaacgctggcttcttttatt cattcgcaacgagcctga

DBGET integrated database retrieval system