KEGG   Salmonella enterica subsp. arizonae: SARI_03611
Entry
SARI_03611        CDS       T00627                                 
Name
(GenBank) hypothetical protein
  KO
K07091  lipopolysaccharide export system permease protein
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ses00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SARI_03611
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ses02000]
    SARI_03611
Transporters [BR:ses02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    SARI_03611
SSDB
Motif
Pfam: LptF_LptG
Other DBs
NCBI-ProteinID: ABX23423
UniProt: A9MI77
LinkDB
Position
3540717..3540896
AA seq 59 aa
MAAVDGDIPANLVLSLLELGVPEMAQLILPLSLFPGLLMTLGKLYTESEIMVMHACGLS
NT seq 180 nt   +upstreamnt  +downstreamnt
ttggcggcggtagacggcgatattcccgccaatctggtgctctcgcttctggagctgggc
gtaccggaaatggcgcagctcatcctgccattaagcctgttcccggggcttctgatgacg
ctgggcaaactgtataccgaaagtgaaattatggtcatgcatgcctgcgggttgagctaa

DBGET integrated database retrieval system