Saccharothrix espanaensis: BN6_32230 Help Entry BN6_32230         CDS       T02404                                  Symbol acp2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism sesp  Saccharothrix espanaensis Pathway sesp00998   Biosynthesis of various antibiotics sesp01100   Metabolic pathways sesp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sesp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BN6_32230 (acp2)    00074 Mycolic acid biosynthesis     BN6_32230 (acp2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BN6_32230 (acp2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  CCH30527 UniProt:  K0JZ41 LinkDB All DBs Position 3429679..3429942 Genome browser AA seq 87 aa AA seqDB search MTSSVSIDADGKAKIKEIVSEILEIDPEEMTDTSLFKEDHDADSLGAIEILSALERTFSV EIDQAELTRMVNLEGVIAVVAEAQAAK NT seq 264 nt NT seq  +upstreamnt  +downstreamnt gtgaccagttcggtgagcatcgacgcggacggcaaggcgaagatcaaggaaatcgtgtcc gagatcctcgagatcgaccccgaggagatgaccgacaccagcctgttcaaggaggaccac gacgccgactcgctgggcgcgatcgagatcctgtccgccctggagcgcacgttcagcgtc gagatcgaccaggccgagctgacccgcatggtcaacctcgaaggcgtcatcgccgtcgtc gccgaagcccaggccgccaagtag

DBGET integrated database retrieval system