Saccharothrix espanaensis: BN6_35410 Help Entry BN6_35410         CDS       T02404                                  Name (GenBank) hypothetical protein   KO K16025   methoxymalonate biosynthesis acyl carrier protein Organism sesp  Saccharothrix espanaensis Pathway sesp01051   Biosynthesis of ansamycins sesp01052   Type I polyketide structures Brite KEGG Orthology (KO) [BR:sesp00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01052 Type I polyketide structures     BN6_35410    01051 Biosynthesis of ansamycins     BN6_35410  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sesp01008]     BN6_35410 Polyketide biosynthesis proteins [BR:sesp01008]  Polyketide tailoring proteins   Others    BN6_35410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  CCH30839 UniProt:  K0K1V1 LinkDB All DBs Position 3835866..3836126 Genome browser AA seq 86 aa AA seqDB search MSTTEQVHSPEEIRANLAEFVEQQTKSAVATDLDLFGSGLVSSLFALQLVVHVETAFGVA VQGADLKLDNFRTIDAITDLVVRLRA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtgagcacgaccgagcaggtgcacagcccggaggagatccgcgcgaacctggcggagttc gtcgagcagcagaccaagtcggcggtggccaccgacctcgacctgttcgggtcgggcctg gtgtcgtcgctgttcgcgctccagctcgtggtgcacgtggagaccgcgttcggggtcgcg gtgcagggtgcggacctcaagctggacaacttccgcaccatcgacgcgatcaccgacctg gtagtgaggctgcgggcgtga

DBGET integrated database retrieval system