KEGG   Suncus etruscus (white-toothed pygmy shrew): 126019084
Entry
126019084         CDS       T09902                                 
Symbol
HRAS
Name
(RefSeq) GTPase HRas
  KO
K02833  GTPase HRas
Organism
setr  Suncus etruscus (white-toothed pygmy shrew)
Pathway
setr01521  EGFR tyrosine kinase inhibitor resistance
setr01522  Endocrine resistance
setr04010  MAPK signaling pathway
setr04012  ErbB signaling pathway
setr04014  Ras signaling pathway
setr04015  Rap1 signaling pathway
setr04062  Chemokine signaling pathway
setr04068  FoxO signaling pathway
setr04071  Sphingolipid signaling pathway
setr04072  Phospholipase D signaling pathway
setr04137  Mitophagy - animal
setr04140  Autophagy - animal
setr04144  Endocytosis
setr04150  mTOR signaling pathway
setr04151  PI3K-Akt signaling pathway
setr04210  Apoptosis
setr04211  Longevity regulating pathway
setr04213  Longevity regulating pathway - multiple species
setr04218  Cellular senescence
setr04360  Axon guidance
setr04370  VEGF signaling pathway
setr04371  Apelin signaling pathway
setr04510  Focal adhesion
setr04540  Gap junction
setr04550  Signaling pathways regulating pluripotency of stem cells
setr04625  C-type lectin receptor signaling pathway
setr04630  JAK-STAT signaling pathway
setr04650  Natural killer cell mediated cytotoxicity
setr04660  T cell receptor signaling pathway
setr04662  B cell receptor signaling pathway
setr04664  Fc epsilon RI signaling pathway
setr04714  Thermogenesis
setr04720  Long-term potentiation
setr04722  Neurotrophin signaling pathway
setr04725  Cholinergic synapse
setr04726  Serotonergic synapse
setr04730  Long-term depression
setr04810  Regulation of actin cytoskeleton
setr04910  Insulin signaling pathway
setr04912  GnRH signaling pathway
setr04915  Estrogen signaling pathway
setr04916  Melanogenesis
setr04917  Prolactin signaling pathway
setr04919  Thyroid hormone signaling pathway
setr04921  Oxytocin signaling pathway
setr04926  Relaxin signaling pathway
setr04929  GnRH secretion
setr04933  AGE-RAGE signaling pathway in diabetic complications
setr04935  Growth hormone synthesis, secretion and action
setr05010  Alzheimer disease
setr05022  Pathways of neurodegeneration - multiple diseases
setr05034  Alcoholism
setr05132  Salmonella infection
setr05160  Hepatitis C
setr05161  Hepatitis B
setr05163  Human cytomegalovirus infection
setr05165  Human papillomavirus infection
setr05166  Human T-cell leukemia virus 1 infection
setr05167  Kaposi sarcoma-associated herpesvirus infection
setr05170  Human immunodeficiency virus 1 infection
setr05200  Pathways in cancer
setr05203  Viral carcinogenesis
setr05205  Proteoglycans in cancer
setr05206  MicroRNAs in cancer
setr05207  Chemical carcinogenesis - receptor activation
setr05208  Chemical carcinogenesis - reactive oxygen species
setr05210  Colorectal cancer
setr05211  Renal cell carcinoma
setr05213  Endometrial cancer
setr05214  Glioma
setr05215  Prostate cancer
setr05216  Thyroid cancer
setr05218  Melanoma
setr05219  Bladder cancer
setr05220  Chronic myeloid leukemia
setr05221  Acute myeloid leukemia
setr05223  Non-small cell lung cancer
setr05224  Breast cancer
setr05225  Hepatocellular carcinoma
setr05226  Gastric cancer
setr05230  Central carbon metabolism in cancer
setr05231  Choline metabolism in cancer
setr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
setr05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:setr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    126019084 (HRAS)
   04012 ErbB signaling pathway
    126019084 (HRAS)
   04014 Ras signaling pathway
    126019084 (HRAS)
   04015 Rap1 signaling pathway
    126019084 (HRAS)
   04370 VEGF signaling pathway
    126019084 (HRAS)
   04371 Apelin signaling pathway
    126019084 (HRAS)
   04630 JAK-STAT signaling pathway
    126019084 (HRAS)
   04068 FoxO signaling pathway
    126019084 (HRAS)
   04072 Phospholipase D signaling pathway
    126019084 (HRAS)
   04071 Sphingolipid signaling pathway
    126019084 (HRAS)
   04151 PI3K-Akt signaling pathway
    126019084 (HRAS)
   04150 mTOR signaling pathway
    126019084 (HRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    126019084 (HRAS)
   04140 Autophagy - animal
    126019084 (HRAS)
   04137 Mitophagy - animal
    126019084 (HRAS)
  09143 Cell growth and death
   04210 Apoptosis
    126019084 (HRAS)
   04218 Cellular senescence
    126019084 (HRAS)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    126019084 (HRAS)
   04540 Gap junction
    126019084 (HRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    126019084 (HRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    126019084 (HRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    126019084 (HRAS)
   04650 Natural killer cell mediated cytotoxicity
    126019084 (HRAS)
   04660 T cell receptor signaling pathway
    126019084 (HRAS)
   04662 B cell receptor signaling pathway
    126019084 (HRAS)
   04664 Fc epsilon RI signaling pathway
    126019084 (HRAS)
   04062 Chemokine signaling pathway
    126019084 (HRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    126019084 (HRAS)
   04929 GnRH secretion
    126019084 (HRAS)
   04912 GnRH signaling pathway
    126019084 (HRAS)
   04915 Estrogen signaling pathway
    126019084 (HRAS)
   04917 Prolactin signaling pathway
    126019084 (HRAS)
   04921 Oxytocin signaling pathway
    126019084 (HRAS)
   04926 Relaxin signaling pathway
    126019084 (HRAS)
   04935 Growth hormone synthesis, secretion and action
    126019084 (HRAS)
   04919 Thyroid hormone signaling pathway
    126019084 (HRAS)
   04916 Melanogenesis
    126019084 (HRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    126019084 (HRAS)
   04726 Serotonergic synapse
    126019084 (HRAS)
   04720 Long-term potentiation
    126019084 (HRAS)
   04730 Long-term depression
    126019084 (HRAS)
   04722 Neurotrophin signaling pathway
    126019084 (HRAS)
  09158 Development and regeneration
   04360 Axon guidance
    126019084 (HRAS)
  09149 Aging
   04211 Longevity regulating pathway
    126019084 (HRAS)
   04213 Longevity regulating pathway - multiple species
    126019084 (HRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    126019084 (HRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    126019084 (HRAS)
   05206 MicroRNAs in cancer
    126019084 (HRAS)
   05205 Proteoglycans in cancer
    126019084 (HRAS)
   05207 Chemical carcinogenesis - receptor activation
    126019084 (HRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    126019084 (HRAS)
   05203 Viral carcinogenesis
    126019084 (HRAS)
   05230 Central carbon metabolism in cancer
    126019084 (HRAS)
   05231 Choline metabolism in cancer
    126019084 (HRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    126019084 (HRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    126019084 (HRAS)
   05225 Hepatocellular carcinoma
    126019084 (HRAS)
   05226 Gastric cancer
    126019084 (HRAS)
   05214 Glioma
    126019084 (HRAS)
   05216 Thyroid cancer
    126019084 (HRAS)
   05221 Acute myeloid leukemia
    126019084 (HRAS)
   05220 Chronic myeloid leukemia
    126019084 (HRAS)
   05218 Melanoma
    126019084 (HRAS)
   05211 Renal cell carcinoma
    126019084 (HRAS)
   05219 Bladder cancer
    126019084 (HRAS)
   05215 Prostate cancer
    126019084 (HRAS)
   05213 Endometrial cancer
    126019084 (HRAS)
   05224 Breast cancer
    126019084 (HRAS)
   05223 Non-small cell lung cancer
    126019084 (HRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    126019084 (HRAS)
   05170 Human immunodeficiency virus 1 infection
    126019084 (HRAS)
   05161 Hepatitis B
    126019084 (HRAS)
   05160 Hepatitis C
    126019084 (HRAS)
   05163 Human cytomegalovirus infection
    126019084 (HRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    126019084 (HRAS)
   05165 Human papillomavirus infection
    126019084 (HRAS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    126019084 (HRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    126019084 (HRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    126019084 (HRAS)
  09165 Substance dependence
   05034 Alcoholism
    126019084 (HRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    126019084 (HRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    126019084 (HRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    126019084 (HRAS)
   01522 Endocrine resistance
    126019084 (HRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:setr04131]
    126019084 (HRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:setr04147]
    126019084 (HRAS)
   04031 GTP-binding proteins [BR:setr04031]
    126019084 (HRAS)
Membrane trafficking [BR:setr04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    126019084 (HRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    126019084 (HRAS)
Exosome [BR:setr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   126019084 (HRAS)
  Exosomal proteins of colorectal cancer cells
   126019084 (HRAS)
GTP-binding proteins [BR:setr04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    126019084 (HRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N
Other DBs
NCBI-GeneID: 126019084
NCBI-ProteinID: XP_049637213
LinkDB
Position
9:complement(114879232..114881597)
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNAKSFEDIHQYREQIKRVKDSDDVPTVLVGNKCDL
AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRLHKARKLSPPDEGGPG
CTSCRCLLS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacggagtataagctggtggtggtgggcgccggcggcgtgggcaagagcgccctgacc
atccagctcatccagaaccactttgtggacgagtatgaccccaccatcgaggactcctat
cggaagcaggtggtcatcgacggggagacgtgcctgctggacatcctggacacggccggc
caggaggagtacagcgccatgcgcgaccagtacatgcgcaccggcgagggcttcctctgc
gtgttcgccatcaacaacgccaagtccttcgaggacatccaccagtacagggagcagatc
aagcgggtgaaggactcagacgacgtgcccaccgtgctggtggggaacaagtgcgacctg
gcggcgcgcaccgtggagtcgcggcaggcgcaggacctggcccgcagctacgggatcccc
tacatcgagacctcggctaagacgcgccagggcgtggaggatgccttctacacgctggtc
cgcgagatccgcctgcacaaggcccgcaagctcagcccgccggacgagggtggcccgggc
tgcaccagctgccgctgcctcctgtcctag

DBGET integrated database retrieval system