KEGG   Suncus etruscus (white-toothed pygmy shrew): 126029893
Entry
126029893         CDS       T09902                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
setr  Suncus etruscus (white-toothed pygmy shrew)
Pathway
setr01521  EGFR tyrosine kinase inhibitor resistance
setr01522  Endocrine resistance
setr01524  Platinum drug resistance
setr04010  MAPK signaling pathway
setr04012  ErbB signaling pathway
setr04014  Ras signaling pathway
setr04015  Rap1 signaling pathway
setr04022  cGMP-PKG signaling pathway
setr04024  cAMP signaling pathway
setr04062  Chemokine signaling pathway
setr04066  HIF-1 signaling pathway
setr04068  FoxO signaling pathway
setr04071  Sphingolipid signaling pathway
setr04072  Phospholipase D signaling pathway
setr04114  Oocyte meiosis
setr04140  Autophagy - animal
setr04148  Efferocytosis
setr04150  mTOR signaling pathway
setr04151  PI3K-Akt signaling pathway
setr04210  Apoptosis
setr04218  Cellular senescence
setr04261  Adrenergic signaling in cardiomyocytes
setr04270  Vascular smooth muscle contraction
setr04350  TGF-beta signaling pathway
setr04360  Axon guidance
setr04370  VEGF signaling pathway
setr04371  Apelin signaling pathway
setr04380  Osteoclast differentiation
setr04510  Focal adhesion
setr04517  IgSF CAM signaling
setr04520  Adherens junction
setr04540  Gap junction
setr04550  Signaling pathways regulating pluripotency of stem cells
setr04611  Platelet activation
setr04613  Neutrophil extracellular trap formation
setr04620  Toll-like receptor signaling pathway
setr04621  NOD-like receptor signaling pathway
setr04625  C-type lectin receptor signaling pathway
setr04650  Natural killer cell mediated cytotoxicity
setr04657  IL-17 signaling pathway
setr04658  Th1 and Th2 cell differentiation
setr04659  Th17 cell differentiation
setr04660  T cell receptor signaling pathway
setr04662  B cell receptor signaling pathway
setr04664  Fc epsilon RI signaling pathway
setr04666  Fc gamma R-mediated phagocytosis
setr04668  TNF signaling pathway
setr04713  Circadian entrainment
setr04720  Long-term potentiation
setr04722  Neurotrophin signaling pathway
setr04723  Retrograde endocannabinoid signaling
setr04724  Glutamatergic synapse
setr04725  Cholinergic synapse
setr04726  Serotonergic synapse
setr04730  Long-term depression
setr04810  Regulation of actin cytoskeleton
setr04910  Insulin signaling pathway
setr04912  GnRH signaling pathway
setr04914  Progesterone-mediated oocyte maturation
setr04915  Estrogen signaling pathway
setr04916  Melanogenesis
setr04917  Prolactin signaling pathway
setr04919  Thyroid hormone signaling pathway
setr04921  Oxytocin signaling pathway
setr04926  Relaxin signaling pathway
setr04928  Parathyroid hormone synthesis, secretion and action
setr04929  GnRH secretion
setr04930  Type II diabetes mellitus
setr04933  AGE-RAGE signaling pathway in diabetic complications
setr04934  Cushing syndrome
setr04935  Growth hormone synthesis, secretion and action
setr04960  Aldosterone-regulated sodium reabsorption
setr05010  Alzheimer disease
setr05020  Prion disease
setr05022  Pathways of neurodegeneration - multiple diseases
setr05034  Alcoholism
setr05132  Salmonella infection
setr05133  Pertussis
setr05135  Yersinia infection
setr05140  Leishmaniasis
setr05142  Chagas disease
setr05145  Toxoplasmosis
setr05152  Tuberculosis
setr05160  Hepatitis C
setr05161  Hepatitis B
setr05163  Human cytomegalovirus infection
setr05164  Influenza A
setr05165  Human papillomavirus infection
setr05166  Human T-cell leukemia virus 1 infection
setr05167  Kaposi sarcoma-associated herpesvirus infection
setr05170  Human immunodeficiency virus 1 infection
setr05171  Coronavirus disease - COVID-19
setr05200  Pathways in cancer
setr05203  Viral carcinogenesis
setr05205  Proteoglycans in cancer
setr05206  MicroRNAs in cancer
setr05207  Chemical carcinogenesis - receptor activation
setr05208  Chemical carcinogenesis - reactive oxygen species
setr05210  Colorectal cancer
setr05211  Renal cell carcinoma
setr05212  Pancreatic cancer
setr05213  Endometrial cancer
setr05214  Glioma
setr05215  Prostate cancer
setr05216  Thyroid cancer
setr05218  Melanoma
setr05219  Bladder cancer
setr05220  Chronic myeloid leukemia
setr05221  Acute myeloid leukemia
setr05223  Non-small cell lung cancer
setr05224  Breast cancer
setr05225  Hepatocellular carcinoma
setr05226  Gastric cancer
setr05230  Central carbon metabolism in cancer
setr05231  Choline metabolism in cancer
setr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
setr05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:setr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    126029893 (MAPK3)
   04012 ErbB signaling pathway
    126029893 (MAPK3)
   04014 Ras signaling pathway
    126029893 (MAPK3)
   04015 Rap1 signaling pathway
    126029893 (MAPK3)
   04350 TGF-beta signaling pathway
    126029893 (MAPK3)
   04370 VEGF signaling pathway
    126029893 (MAPK3)
   04371 Apelin signaling pathway
    126029893 (MAPK3)
   04668 TNF signaling pathway
    126029893 (MAPK3)
   04066 HIF-1 signaling pathway
    126029893 (MAPK3)
   04068 FoxO signaling pathway
    126029893 (MAPK3)
   04072 Phospholipase D signaling pathway
    126029893 (MAPK3)
   04071 Sphingolipid signaling pathway
    126029893 (MAPK3)
   04024 cAMP signaling pathway
    126029893 (MAPK3)
   04022 cGMP-PKG signaling pathway
    126029893 (MAPK3)
   04151 PI3K-Akt signaling pathway
    126029893 (MAPK3)
   04150 mTOR signaling pathway
    126029893 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    126029893 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    126029893 (MAPK3)
   04148 Efferocytosis
    126029893 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    126029893 (MAPK3)
   04210 Apoptosis
    126029893 (MAPK3)
   04218 Cellular senescence
    126029893 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    126029893 (MAPK3)
   04520 Adherens junction
    126029893 (MAPK3)
   04540 Gap junction
    126029893 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    126029893 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    126029893 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    126029893 (MAPK3)
   04613 Neutrophil extracellular trap formation
    126029893 (MAPK3)
   04620 Toll-like receptor signaling pathway
    126029893 (MAPK3)
   04621 NOD-like receptor signaling pathway
    126029893 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    126029893 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    126029893 (MAPK3)
   04660 T cell receptor signaling pathway
    126029893 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    126029893 (MAPK3)
   04659 Th17 cell differentiation
    126029893 (MAPK3)
   04657 IL-17 signaling pathway
    126029893 (MAPK3)
   04662 B cell receptor signaling pathway
    126029893 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    126029893 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    126029893 (MAPK3)
   04062 Chemokine signaling pathway
    126029893 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    126029893 (MAPK3)
   04929 GnRH secretion
    126029893 (MAPK3)
   04912 GnRH signaling pathway
    126029893 (MAPK3)
   04915 Estrogen signaling pathway
    126029893 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    126029893 (MAPK3)
   04917 Prolactin signaling pathway
    126029893 (MAPK3)
   04921 Oxytocin signaling pathway
    126029893 (MAPK3)
   04926 Relaxin signaling pathway
    126029893 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    126029893 (MAPK3)
   04919 Thyroid hormone signaling pathway
    126029893 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    126029893 (MAPK3)
   04916 Melanogenesis
    126029893 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    126029893 (MAPK3)
   04270 Vascular smooth muscle contraction
    126029893 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    126029893 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    126029893 (MAPK3)
   04725 Cholinergic synapse
    126029893 (MAPK3)
   04726 Serotonergic synapse
    126029893 (MAPK3)
   04720 Long-term potentiation
    126029893 (MAPK3)
   04730 Long-term depression
    126029893 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    126029893 (MAPK3)
   04722 Neurotrophin signaling pathway
    126029893 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    126029893 (MAPK3)
   04380 Osteoclast differentiation
    126029893 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    126029893 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    126029893 (MAPK3)
   05206 MicroRNAs in cancer
    126029893 (MAPK3)
   05205 Proteoglycans in cancer
    126029893 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    126029893 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    126029893 (MAPK3)
   05203 Viral carcinogenesis
    126029893 (MAPK3)
   05230 Central carbon metabolism in cancer
    126029893 (MAPK3)
   05231 Choline metabolism in cancer
    126029893 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    126029893 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    126029893 (MAPK3)
   05212 Pancreatic cancer
    126029893 (MAPK3)
   05225 Hepatocellular carcinoma
    126029893 (MAPK3)
   05226 Gastric cancer
    126029893 (MAPK3)
   05214 Glioma
    126029893 (MAPK3)
   05216 Thyroid cancer
    126029893 (MAPK3)
   05221 Acute myeloid leukemia
    126029893 (MAPK3)
   05220 Chronic myeloid leukemia
    126029893 (MAPK3)
   05218 Melanoma
    126029893 (MAPK3)
   05211 Renal cell carcinoma
    126029893 (MAPK3)
   05219 Bladder cancer
    126029893 (MAPK3)
   05215 Prostate cancer
    126029893 (MAPK3)
   05213 Endometrial cancer
    126029893 (MAPK3)
   05224 Breast cancer
    126029893 (MAPK3)
   05223 Non-small cell lung cancer
    126029893 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    126029893 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    126029893 (MAPK3)
   05161 Hepatitis B
    126029893 (MAPK3)
   05160 Hepatitis C
    126029893 (MAPK3)
   05171 Coronavirus disease - COVID-19
    126029893 (MAPK3)
   05164 Influenza A
    126029893 (MAPK3)
   05163 Human cytomegalovirus infection
    126029893 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    126029893 (MAPK3)
   05165 Human papillomavirus infection
    126029893 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    126029893 (MAPK3)
   05135 Yersinia infection
    126029893 (MAPK3)
   05133 Pertussis
    126029893 (MAPK3)
   05152 Tuberculosis
    126029893 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    126029893 (MAPK3)
   05140 Leishmaniasis
    126029893 (MAPK3)
   05142 Chagas disease
    126029893 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    126029893 (MAPK3)
   05020 Prion disease
    126029893 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    126029893 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    126029893 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    126029893 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    126029893 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    126029893 (MAPK3)
   04934 Cushing syndrome
    126029893 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    126029893 (MAPK3)
   01524 Platinum drug resistance
    126029893 (MAPK3)
   01522 Endocrine resistance
    126029893 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:setr01001]
    126029893 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:setr03036]
    126029893 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:setr04147]
    126029893 (MAPK3)
Enzymes [BR:setr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     126029893 (MAPK3)
Protein kinases [BR:setr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   126029893 (MAPK3)
Chromosome and associated proteins [BR:setr03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     126029893 (MAPK3)
Exosome [BR:setr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   126029893 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 126029893
NCBI-ProteinID: XP_049644095
LinkDB
Position
15:complement(60425574..60431691)
AA seq 383 aa
MAAPAAAAAAPGGGGGEPRGAAGVGQGVPGEVELVKGQPFDVGPRYTQLQYIGEGAYGMV
SSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMR
DVYIVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINT
TCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILA
EMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPPKTKVAWPKLF
PKSDSKALDLLDRMLTFNPNKRITVEEALAHPYVDQYYDPTDEPVAEEPFTFDMELDDLP
KERLKELIFQETAPFQPGALKAP
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggcggcgccggcggcggcggcggcggctccggggggcgggggcggggagccccgggga
gctgctggggtcggccagggggtcccgggggaggtggagctggtgaaggggcagccgttc
gacgtgggcccgcgctacacgcagctgcagtacatcggcgagggggcctacggcatggtc
agctcagcttacgaccacgtgcgcaagactcgggtggccatcaagaaaatcagccccttc
gagcaccagacctactgccagcgcacgctgcgggagatccagatcttgctgcgtttccgc
cacgagaatgtcatcggcattcgggacatcctgcgggcccccaccctggaggctatgagg
gatgtctatattgttcaggacctgatggagacagacctgtacaagttgctcaaaagccag
cagttgagcaacgaccatgtctgctacttcctctaccagattcttcggggcctcaagtac
atccactcagccaacgtgctccaccgggatttaaagccttccaacctgctcatcaatacc
acctgcgaccttaagatctgcgattttggcctggccaggattgccgatcctgagcacgac
cacacaggcttcctaacagaatatgtggcaacacgctggtaccgggccccagagattatg
ctgaattccaagggctataccaagtccattgacatctggtctgtgggctgcattctggct
gagatgctctccaaccggcccatctttcctggcaagcactacctagaccagctcaaccac
attctgggtatcctgggctccccatcccaggaggacctgaactgtatcatcaacatgaag
gcccgaaactacttacagtctttaccccccaagaccaaggtggcctggcccaagcttttt
cccaagtcagattccaaagccctggacctgctggaccggatgttgacctttaaccccaac
aaacggatcacagtagaagaagcattggctcacccctatgtggaccagtactatgaccca
acggatgagccggtggccgaggaacctttcactttcgacatggagctggatgacctaccg
aaggagcgactgaaggagctcatcttccaagaaacggccccctttcagccgggggcactt
aaggccccctaa

DBGET integrated database retrieval system