KEGG   Suncus etruscus (white-toothed pygmy shrew): 126030488
Entry
126030488         CDS       T09902                                 
Symbol
RAC1
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1 isoform X1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
setr  Suncus etruscus (white-toothed pygmy shrew)
Pathway
setr04010  MAPK signaling pathway
setr04014  Ras signaling pathway
setr04015  Rap1 signaling pathway
setr04024  cAMP signaling pathway
setr04062  Chemokine signaling pathway
setr04071  Sphingolipid signaling pathway
setr04145  Phagosome
setr04148  Efferocytosis
setr04151  PI3K-Akt signaling pathway
setr04310  Wnt signaling pathway
setr04360  Axon guidance
setr04370  VEGF signaling pathway
setr04380  Osteoclast differentiation
setr04510  Focal adhesion
setr04517  IgSF CAM signaling
setr04518  Integrin signaling
setr04520  Adherens junction
setr04530  Tight junction
setr04613  Neutrophil extracellular trap formation
setr04620  Toll-like receptor signaling pathway
setr04650  Natural killer cell mediated cytotoxicity
setr04662  B cell receptor signaling pathway
setr04664  Fc epsilon RI signaling pathway
setr04666  Fc gamma R-mediated phagocytosis
setr04670  Leukocyte transendothelial migration
setr04722  Neurotrophin signaling pathway
setr04810  Regulation of actin cytoskeleton
setr04932  Non-alcoholic fatty liver disease
setr04933  AGE-RAGE signaling pathway in diabetic complications
setr04972  Pancreatic secretion
setr05014  Amyotrophic lateral sclerosis
setr05020  Prion disease
setr05022  Pathways of neurodegeneration - multiple diseases
setr05100  Bacterial invasion of epithelial cells
setr05132  Salmonella infection
setr05135  Yersinia infection
setr05163  Human cytomegalovirus infection
setr05167  Kaposi sarcoma-associated herpesvirus infection
setr05169  Epstein-Barr virus infection
setr05170  Human immunodeficiency virus 1 infection
setr05200  Pathways in cancer
setr05203  Viral carcinogenesis
setr05205  Proteoglycans in cancer
setr05208  Chemical carcinogenesis - reactive oxygen species
setr05210  Colorectal cancer
setr05211  Renal cell carcinoma
setr05212  Pancreatic cancer
setr05231  Choline metabolism in cancer
setr05415  Diabetic cardiomyopathy
setr05416  Viral myocarditis
setr05417  Lipid and atherosclerosis
setr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:setr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    126030488 (RAC1)
   04014 Ras signaling pathway
    126030488 (RAC1)
   04015 Rap1 signaling pathway
    126030488 (RAC1)
   04310 Wnt signaling pathway
    126030488 (RAC1)
   04370 VEGF signaling pathway
    126030488 (RAC1)
   04071 Sphingolipid signaling pathway
    126030488 (RAC1)
   04024 cAMP signaling pathway
    126030488 (RAC1)
   04151 PI3K-Akt signaling pathway
    126030488 (RAC1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    126030488 (RAC1)
   04518 Integrin signaling
    126030488 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    126030488 (RAC1)
   04148 Efferocytosis
    126030488 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    126030488 (RAC1)
   04520 Adherens junction
    126030488 (RAC1)
   04530 Tight junction
    126030488 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    126030488 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    126030488 (RAC1)
   04620 Toll-like receptor signaling pathway
    126030488 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    126030488 (RAC1)
   04662 B cell receptor signaling pathway
    126030488 (RAC1)
   04664 Fc epsilon RI signaling pathway
    126030488 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    126030488 (RAC1)
   04670 Leukocyte transendothelial migration
    126030488 (RAC1)
   04062 Chemokine signaling pathway
    126030488 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    126030488 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    126030488 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    126030488 (RAC1)
   04380 Osteoclast differentiation
    126030488 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    126030488 (RAC1)
   05205 Proteoglycans in cancer
    126030488 (RAC1)
   05208 Chemical carcinogenesis - reactive oxygen species
    126030488 (RAC1)
   05203 Viral carcinogenesis
    126030488 (RAC1)
   05231 Choline metabolism in cancer
    126030488 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    126030488 (RAC1)
   05212 Pancreatic cancer
    126030488 (RAC1)
   05211 Renal cell carcinoma
    126030488 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    126030488 (RAC1)
   05163 Human cytomegalovirus infection
    126030488 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    126030488 (RAC1)
   05169 Epstein-Barr virus infection
    126030488 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    126030488 (RAC1)
   05135 Yersinia infection
    126030488 (RAC1)
   05100 Bacterial invasion of epithelial cells
    126030488 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    126030488 (RAC1)
   05020 Prion disease
    126030488 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    126030488 (RAC1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    126030488 (RAC1)
   05418 Fluid shear stress and atherosclerosis
    126030488 (RAC1)
   05415 Diabetic cardiomyopathy
    126030488 (RAC1)
   05416 Viral myocarditis
    126030488 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    126030488 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    126030488 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:setr04131]
    126030488 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:setr04147]
    126030488 (RAC1)
   04031 GTP-binding proteins [BR:setr04031]
    126030488 (RAC1)
Membrane trafficking [BR:setr04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    126030488 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    126030488 (RAC1)
  Macropinocytosis
   Ras GTPases
    126030488 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    126030488 (RAC1)
Exosome [BR:setr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   126030488 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   126030488 (RAC1)
  Exosomal proteins of colorectal cancer cells
   126030488 (RAC1)
  Exosomal proteins of bladder cancer cells
   126030488 (RAC1)
GTP-binding proteins [BR:setr04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    126030488 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU CagD
Other DBs
NCBI-GeneID: 126030488
NCBI-ProteinID: XP_049644660
LinkDB
Position
15:77396093..77410817
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagccgtgggtaagacatgcctcctg
atcagctacacgaccaatgccttccctggcgagtacatccctactgtcttcgacaactac
tcggccaatgtcatggtcgatgggaagccagtgaacctgggcctatgggacacggcaggc
caggaggactacgacaggctgcggcctctgtcctacccacagacggacgtgttcctcatc
tgcttctctctcgtgagtcctgcgtcctttgagaacgtgcgtgcgaagtggtaccctgag
gtgcgacatcactgccccaacacccccatcatcctggtgggcaccaagctggatctccgg
gacgacaaagacacaattgagaagctgaaggagaaaaagctgacacccatcacctaccca
cagggcctggccatggccaaggagatcggtgctgtgaagtacctggagtgctcggcactc
acccaacggggcctcaagaccgtgttcgacgaagccatccgggccgtgctctgcccacca
cctgtcaagaagcggaagcggaagtgcctgctgctgtga

DBGET integrated database retrieval system