KEGG   Suncus etruscus (white-toothed pygmy shrew): 126031280
Entry
126031280         CDS       T09902                                 
Name
(RefSeq) calmodulin-1-like
  KO
K02183  calmodulin
Organism
setr  Suncus etruscus (white-toothed pygmy shrew)
Pathway
setr04014  Ras signaling pathway
setr04015  Rap1 signaling pathway
setr04020  Calcium signaling pathway
setr04022  cGMP-PKG signaling pathway
setr04024  cAMP signaling pathway
setr04070  Phosphatidylinositol signaling system
setr04114  Oocyte meiosis
setr04218  Cellular senescence
setr04261  Adrenergic signaling in cardiomyocytes
setr04270  Vascular smooth muscle contraction
setr04371  Apelin signaling pathway
setr04625  C-type lectin receptor signaling pathway
setr04713  Circadian entrainment
setr04720  Long-term potentiation
setr04722  Neurotrophin signaling pathway
setr04728  Dopaminergic synapse
setr04740  Olfactory transduction
setr04744  Phototransduction
setr04750  Inflammatory mediator regulation of TRP channels
setr04910  Insulin signaling pathway
setr04912  GnRH signaling pathway
setr04915  Estrogen signaling pathway
setr04916  Melanogenesis
setr04921  Oxytocin signaling pathway
setr04922  Glucagon signaling pathway
setr04924  Renin secretion
setr04925  Aldosterone synthesis and secretion
setr04970  Salivary secretion
setr04971  Gastric acid secretion
setr05010  Alzheimer disease
setr05012  Parkinson disease
setr05022  Pathways of neurodegeneration - multiple diseases
setr05031  Amphetamine addiction
setr05034  Alcoholism
setr05133  Pertussis
setr05152  Tuberculosis
setr05163  Human cytomegalovirus infection
setr05167  Kaposi sarcoma-associated herpesvirus infection
setr05170  Human immunodeficiency virus 1 infection
setr05200  Pathways in cancer
setr05214  Glioma
setr05417  Lipid and atherosclerosis
setr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:setr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    126031280
   04015 Rap1 signaling pathway
    126031280
   04371 Apelin signaling pathway
    126031280
   04020 Calcium signaling pathway
    126031280
   04070 Phosphatidylinositol signaling system
    126031280
   04024 cAMP signaling pathway
    126031280
   04022 cGMP-PKG signaling pathway
    126031280
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    126031280
   04218 Cellular senescence
    126031280
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    126031280
  09152 Endocrine system
   04910 Insulin signaling pathway
    126031280
   04922 Glucagon signaling pathway
    126031280
   04912 GnRH signaling pathway
    126031280
   04915 Estrogen signaling pathway
    126031280
   04921 Oxytocin signaling pathway
    126031280
   04916 Melanogenesis
    126031280
   04924 Renin secretion
    126031280
   04925 Aldosterone synthesis and secretion
    126031280
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    126031280
   04270 Vascular smooth muscle contraction
    126031280
  09154 Digestive system
   04970 Salivary secretion
    126031280
   04971 Gastric acid secretion
    126031280
  09156 Nervous system
   04728 Dopaminergic synapse
    126031280
   04720 Long-term potentiation
    126031280
   04722 Neurotrophin signaling pathway
    126031280
  09157 Sensory system
   04744 Phototransduction
    126031280
   04740 Olfactory transduction
    126031280
   04750 Inflammatory mediator regulation of TRP channels
    126031280
  09159 Environmental adaptation
   04713 Circadian entrainment
    126031280
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    126031280
  09162 Cancer: specific types
   05214 Glioma
    126031280
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    126031280
   05163 Human cytomegalovirus infection
    126031280
   05167 Kaposi sarcoma-associated herpesvirus infection
    126031280
  09171 Infectious disease: bacterial
   05133 Pertussis
    126031280
   05152 Tuberculosis
    126031280
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    126031280
   05012 Parkinson disease
    126031280
   05022 Pathways of neurodegeneration - multiple diseases
    126031280
  09165 Substance dependence
   05031 Amphetamine addiction
    126031280
   05034 Alcoholism
    126031280
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    126031280
   05418 Fluid shear stress and atherosclerosis
    126031280
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:setr01009]
    126031280
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:setr04131]
    126031280
   03036 Chromosome and associated proteins [BR:setr03036]
    126031280
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:setr04147]
    126031280
Protein phosphatases and associated proteins [BR:setr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     126031280
Membrane trafficking [BR:setr04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    126031280
Chromosome and associated proteins [BR:setr03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     126031280
Exosome [BR:setr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   126031280
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 SAPC2_N EF-hand_EFHB_C Dockerin_1 EFhand_Ca_insen Caleosin DUF5580_M FCaBP_EF-hand TerB DUF1103 EF-hand_STIM1 SPEF2_C SurA_N_3 PA_Ig-like MotA_activ DUF2267
Other DBs
NCBI-GeneID: 126031280
NCBI-ProteinID: XP_049645536
LinkDB
Position
15:complement(65115005..65116166)
AA seq 149 aa
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRNVMTNLGEKLTDE
EVDEMIREADIDGDGQVNYEEFVQMMTAK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggctgaccaactgactgaagagcagattgcagaattcaaagaagccttttcactattt
gataaggatggtgatgggactataacaactaaggagttgggaacagtaatgaggtctctg
ggtcagaatcccacggaagccgagttacaggacatgattaatgaagtagatgctgacggt
aatggcacaattgacttcccagaatttctgactatgatggcaagaaaaatgaaagataca
gatagtgaagaggaaattagagaagcattccgtgtgtttgataaggatggcaatggctat
ataagtgcagctgaacttcgcaatgtgatgacaaacctgggagagaagttaacagatgag
gaggttgatgaaatgatcagggaagcagatattgatggtgatggtcaagtaaactatgaa
gagtttgtacagatgatgacagcaaagtga

DBGET integrated database retrieval system