KEGG   Suncus etruscus (white-toothed pygmy shrew): 126033463
Entry
126033463         CDS       T09902                                 
Symbol
CCDC172
Name
(RefSeq) coiled-coil domain-containing protein 172
  KO
K25624  coiled-coil domain-containing protein 172
Organism
setr  Suncus etruscus (white-toothed pygmy shrew)
Brite
KEGG Orthology (KO) [BR:setr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:setr03037]
    126033463 (CCDC172)
Cilium and associated proteins [BR:setr03037]
 Motile cilia and associated proteins
  Sperm associated proteins
   126033463 (CCDC172)
SSDB
Motif
Pfam: CEP15-like
Other DBs
NCBI-GeneID: 126033463
NCBI-ProteinID: XP_049646395
LinkDB
Position
17:62634385..62712701
AA seq 260 aa
MSLESLLQHILCSEHQAEEGRRLQREVRAEISKSRERIRTAAELLQQDKMRLESKVQQFS
EKSFILQILKAQENALERQCSEITSQRNMLLQTFENITKNITEEEEKFMKEIKDFNNEYE
ITRKRELLMKENVKIEMSDLENQANLLKMEMKLMEHDSDQLAQLQRQKNELLQELFALQE
KLKVFEDKENEAICTTKHLEAEKIEISKKPQNDAECLRLKRELDFYKDEDMQSIYESLQT
EIEFLELTLAQKELQKTTKN
NT seq 783 nt   +upstreamnt  +downstreamnt
atgagcctggagtccctattgcagcacatcctctgctcagagcaccaggccgaggagggc
cgccgcctgcagcgggaagtgagggcagaaataagcaaatcccgggagcgaatccggaca
gcggctgagttgctccagcaggacaagatgcggttggaatcaaaggttcagcagttttct
gaaaaatccttcatcctacagattttgaaagctcaagaaaatgctttagaaagacaatgc
agtgaaattacaagccagaggaatatgcttctccaaacatttgagaatataacaaaaaat
ataacagaagaggaggaaaaatttatgaaggaaattaaagacttcaacaatgaatatgaa
ataaccagaaaaagagagcttttgatgaaagaaaatgtcaagattgaaatgtctgaccta
gaaaaccaagcaaaccttttgaaaatggaaatgaaattaatggaacatgatagtgaccag
ttagctcaacttcaaagacaaaagaatgaattattacaagagttatttgcactccaagaa
aaacttaaagtttttgaagataaagaaaatgaagccatttgtactacgaaacatttagaa
gcagaaaaaatagaaatcagtaaaaagcctcaaaatgatgctgaatgtttaagactcaaa
agagaattagacttttataaggatgaggacatgcagagcatatatgaatctctccaaaca
gaaatagaatttttggagttgacattggcacagaaagagcttcagaaaaccactaagaat
tga

DBGET integrated database retrieval system