Saccharomyces eubayanus: DI49_2398 Help Entry DI49_2398         CDS       T08138                                  Name (RefSeq) RPB11-like protein   KO K03008   DNA-directed RNA polymerase II subunit RPB11 Organism seub  Saccharomyces eubayanus Pathway seub03020   RNA polymerase seub03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:seub00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     DI49_2398   09124 Replication and repair    03420 Nucleotide excision repair     DI49_2398  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:seub03021]     DI49_2398    03400 DNA repair and recombination proteins [BR:seub03400]     DI49_2398 Transcription machinery [BR:seub03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Core subunits      DI49_2398 DNA repair and recombination proteins [BR:seub03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       DI49_2398 SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_L_2 RNA_pol_L Motif Other DBs NCBI-GeneID:  28931535 NCBI-ProteinID:  XP_018221780 UniProt:  A0ABN8VKI1 LinkDB All DBs Position XV:complement(<284358..>284726) Genome browser AA seq 122 aa AA seqDB search MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF NM NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgaatgctccagacagatttgaactattcctgctgggtgagggggagtccaagctaaag atcgagcccgacaccaaggcccccaacgccgtggtgatcacgttcgagaaggaggaccac acgctgggcaacctgattcgcgcagagctgcttaacgacaggaaggtgctgtttgccgcc tacaaggtcgagcaccccttctttgcccggttcaagctgagaattcagaccaccgagggc tacgaccccaaggacgccttgaaaaacgcctgcaacagcattatcaataagctgggcgcg ctgaagacgaacttcgagaccgagtggaatctgcagaccctggccgccgacgacgcattc aatatgtaa

DBGET integrated database retrieval system