Shewanella eurypsychrophilus: FM038_023625 Help Entry FM038_023625      CDS       T07746                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism seur  Shewanella eurypsychrophilus Pathway seur01100   Metabolic pathways seur01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:seur00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FM038_023625    00074 Mycolic acid biosynthesis     FM038_023625   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FM038_023625 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QPG60632 LinkDB All DBs Position 5519874..5520128 Genome browser AA seq 84 aa AA seqDB search MKLHNEIKQLIIDCLDLEDVTIDDIDTDAALFGEGLGLDSIDALELGLAIKKQFDVKIEA NSDATKAHFYSVASLASFIESQRA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaaactacataacgaaataaaacaattgattatagattgcctcgatctcgaagatgtc actatcgatgatattgacactgatgcagcactttttggtgaaggtttaggcttagactct atcgatgctcttgagcttggcttagcaattaaaaagcagttcgatgtcaaaatagaagcg aactctgatgccacgaaagcacacttttatagcgtggcgagtctagccagctttattgaa tcacagcgagcttag

DBGET integrated database retrieval system