Shewanella eurypsychrophilus: FM038_023630 Help Entry FM038_023630      CDS       T07746                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism seur  Shewanella eurypsychrophilus Pathway seur01100   Metabolic pathways seur01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:seur00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FM038_023630    00074 Mycolic acid biosynthesis     FM038_023630   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FM038_023630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding WGG DIMCO_N Prenyltransf Motif Other DBs NCBI-ProteinID:  QPG60013 LinkDB All DBs Position 5520137..5520385 Genome browser AA seq 82 aa AA seqDB search MQSREDILEALTQILVDEFEIDAEDISPEASLYQELDLDSIDAVDLVIKLQQMTGKKIKP EEFKTVRTVDDVVTAIEGLVKE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcaaagccgtgaagacattcttgaagcactaacgcaaattttagtcgatgaatttgag atcgatgcagaggatatttcaccagaagcctctctttatcaagaattggatttagacagc attgatgccgtggacttagtcattaagctacaacagatgactggcaaaaaaataaagcct gaagaatttaaaaccgtacgcacagtagatgatgtcgttacggctatcgaagggctcgtt aaagagtaa

DBGET integrated database retrieval system