Streptomyces explomaris: SLV14_001695 Help Entry SLV14_001695      CDS       T11122                                  Name (GenBank) tautomerase family protein   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism sexp  Streptomyces explomaris Pathway sexp00362   Benzoate degradation sexp00622   Xylene degradation sexp01100   Metabolic pathways sexp01120   Microbial metabolism in diverse environments sexp01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:sexp00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     SLV14_001695    00622 Xylene degradation     SLV14_001695    00621 Dioxin degradation     SLV14_001695 Enzymes [BR:sexp01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      SLV14_001695 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Motif Other DBs NCBI-ProteinID:  UYB39225 LinkDB All DBs Position complement(1979826..1979999) Genome browser AA seq 57 aa AA seqDB search MMSGRRQGGKGIDLAGSAAGLRGSGPDPTDAFVDAYRIPAESVTVWIQEVPTRQLGL NT seq 174 nt NT seq  +upstreamnt  +downstreamnt atgatgtccgggcggcggcagggcggcaagggaattgacctggcggggagcgccgccggg ctcagggggagcgggcctgaccccaccgatgcgttcgtggacgcgtaccggatccccgcc gagagcgtgacggtctggatccaggaagtacccacccgacagctgggcctgtga

DBGET integrated database retrieval system