Streptomyces explomaris: SLV14_005513 Help Entry SLV14_005513      CDS       T11122                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sexp  Streptomyces explomaris Pathway sexp00998   Biosynthesis of various antibiotics sexp01100   Metabolic pathways sexp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sexp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SLV14_005513    00074 Mycolic acid biosynthesis     SLV14_005513   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SLV14_005513 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  UYB42622 LinkDB All DBs Position complement(6303757..6304005) Genome browser AA seq 82 aa AA seqDB search MAATQEEIVAGLAEIVNEIAGIPTEDVQVDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKNLKTVGDATEYILKHQS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcgtcgccggtctcgccgagatcgtgaacgagatcgcc gggatccccaccgaggacgtccaggtggacaagtccttcaccgacgacctggacgttgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtgaagatcccg gacgacgacgtcaagaacctcaagacggtcggcgacgcgaccgagtacatcctcaagcac cagagctga

DBGET integrated database retrieval system