Streptomyces pratensis: Sfla_1957 Help Entry Sfla_1957         CDS       T01647                                  Name (GenBank) ATP synthase F0, C subunit   KO K02110   F-type H+-transporting ATPase subunit c Organism sfa  Streptomyces pratensis Pathway sfa00190   Oxidative phosphorylation sfa01100   Metabolic pathways Module sfa_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sfa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Sfla_1957  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sfa00194]     Sfla_1957 Photosynthesis proteins [BR:sfa00194]  Photosystem and electron transport system   F-type ATPase [OT]    Sfla_1957 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  ADW03391 UniProt:  A0A8D3WEE6 LinkDB All DBs Position complement(2380032..2380277) Genome browser AA seq 81 aa AA seqDB search MSALETLAAVNITGNLGSIGYGLAAIGPGVGVGIIFGNGTQALARQPEAAGLIRSNQILG FVLCEALALIGLVMPFVYPVD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgtccgctcttgagaccctcgccgccgtcaacatcacgggcaacctcggttccatcggc tacggcctcgccgcgatcggccccggcgtcggcgtcggcatcatcttcggtaacggcacc caggcgctggcccgtcagcccgaagctgccggcctgatccgctcgaaccagatcctcggc ttcgtgctctgtgaggcgctcgccctgatcggtctcgtcatgcccttcgtctacccggtc gactaa

DBGET integrated database retrieval system