Streptomyces fradiae: CP974_20605 Help Entry CP974_20605       CDS       T07648                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism sfb  Streptomyces fradiae Brite KEGG Orthology (KO) [BR:sfb00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     CP974_20605 Enzymes [BR:sfb01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      CP974_20605 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Thioredoxin Glrx-like GST_N_3 GST_N_2 Motif Other DBs NCBI-ProteinID:  QEV13993 LinkDB All DBs Position complement(4573770..4574027) Genome browser AA seq 85 aa AA seqDB search MQGTVTMYSTTWCGYCRRLKSQMDREGIAYNEINIEQDPESAAFVEKVNNGNQTVPTVLI TPHGGGEDVVMTNPSLMQVRQALAG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcagggcactgtgacgatgtacagcacgacctggtgcgggtactgccggcggctcaag agccagatggaccgcgagggcatcgcgtacaacgagatcaacatcgagcaggacccggag tccgccgccttcgtggagaaggtcaacaacggcaaccagaccgtgccgaccgtgctgatc acgccgcacggcggcggtgaggacgtcgtcatgaccaacccgagcctgatgcaggtgcgg caggccctcgccggctga

DBGET integrated database retrieval system