KEGG   Streptomyces fradiae: CP974_24300
Entry
CP974_24300       CDS       T07648                                 
Name
(GenBank) cytochrome P450
  KO
K22997  cyclooctat-9-en-7-ol 5-monooxygenase [EC:1.14.99.61]
Organism
sfb  Streptomyces fradiae
Pathway
sfb00997  Biosynthesis of various other secondary metabolites
sfb01100  Metabolic pathways
sfb01110  Biosynthesis of secondary metabolites
Module
sfb_M00921  Cyclooctatin biosynthesis, dimethylallyl-PP + isopentenyl-PP => cyclooctatin
Brite
KEGG Orthology (KO) [BR:sfb00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various other secondary metabolites
    CP974_24300
Enzymes [BR:sfb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.61  cyclooctat-9-en-7-ol 5-monooxygenase
     CP974_24300
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: QEV15987
LinkDB
Position
5496042..5497490
AA seq 482 aa
MSGSSGSSGSSAPSGSAAPSAPPAPAGSSVPSVSAGSSAPGGPWRAGTAPGAVPLLGHVP
ALWRRPLEFLASLPAHGDLVELRLGPTRAYLAAHPELVRNVLLDTRAFEKGGVFDKARQL
LGNSLSVSRGEEHRFQRRLLQPAFHPTKIAAYTTAVADDTRAVTDTWRAGQTLDVSDVMH
ALLMRIAARTLFSAGLDDATIEEARQCLRTVSHGIYRRTVAPLGILEKLPTPGNRAYDRA
NARLRRIVAEMIDRRRSGGDADDMLSTLLRAEHPETGERLDEGQVLDQVVTFLVAGSETT
ASTLAFVFHLMGTLPEVEARVHAEVDGVLAGRAPAYDDLPLLPCTRNVITEALRLHPPSW
MAMRVTARDVELGPRTLPARTMVLYSAYALHHNPELFPDPETFDPDRWTPERAARVPRGA
LLPFGAGSHKCIGDVLALTETALVVATVAARWRLRPAPGTRLRPQPKATLEPGPLPMVLE
RR
NT seq 1449 nt   +upstreamnt  +downstreamnt
ctgtccgggtcgtccgggtcgtccgggtcgtccgcgccgtcaggatccgcggcaccctcg
gcgccgcccgcgcccgccgggtcctccgtaccttcggtatccgccgggtcctccgcgccc
ggcgggccgtggcgggccggtaccgctcccggcgccgtcccgctcctcggccacgtgccc
gcgctctggcgccgccccctggagttcctggcctcgctgcccgcccacggcgacctggtc
gagctgcggctcggccccaccagggcctacctggccgcccaccccgaactcgtacggaac
gtcctgctcgacacccgcgccttcgagaagggcggcgtcttcgacaaggcccgccaactc
ctcggcaacagcctgtcggtctcgcgcggcgaggagcaccgcttccagcggcggctgctc
cagcccgccttccacccgacgaagatcgccgcctacaccaccgccgtggccgacgacacc
cgcgccgtcaccgacacctggcgagcggggcagaccctcgacgtcagcgacgtcatgcac
gcgctgctgatgcggatcgcggcccgcaccctcttctccgccgggctcgacgacgcgacg
atcgaggaggcccggcagtgcctgcgcacggtgtcccacggcatctaccggcgcaccgtc
gcccccctcggcatcctcgagaagctgcccaccccggggaaccgggcctacgaccgcgcc
aacgccaggctccggcggatcgtcgccgagatgatcgaccggcgccgctccggcggcgac
gcggacgacatgctctccaccctgctgcgggccgagcaccccgagaccggcgagcgactg
gacgagggccaggtcctcgaccaggtcgtcaccttcctcgtcgcgggcagcgagaccacc
gcctccacgctcgccttcgtcttccacctgatgggcacgctgcccgaggtggaggcgcgg
gtgcacgccgaggtggacggggtgctggcgggccgcgcaccggcctacgacgacctgccc
ctcctgccctgtacgcgcaacgtcatcaccgaggcgctgcgcctccacccgccgtcctgg
atggcgatgcgggtcaccgcccgcgacgtcgagctgggcccccggaccctcccggcccgg
acgatggtcctctacagcgcctacgccctgcaccacaatccggagctcttccccgacccc
gagaccttcgaccccgaccgctggacgcccgaacgggccgcgcgggtgccccgcggcgcg
ctgctgccgttcggcgcggggagccacaagtgcatcggcgacgtgctggcgctcaccgag
accgccctggtcgtcgcgaccgtcgccgcccgctggcggctgcgccccgcgcccggcacc
cgactgcgcccgcagccgaaggccaccctcgaaccgggccccctgccgatggtcctggaa
cggcgctga

DBGET integrated database retrieval system