KEGG   Spirochaeta africana: Spiaf_1303
Entry
Spiaf_1303        CDS       T01811                                 
Name
(GenBank) acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II
  KO
K01897  long-chain-fatty-acid---CoA ligase [EC:6.2.1.3]
Organism
sfc  Spirochaeta africana
Pathway
sfc00061  Fatty acid biosynthesis
sfc00071  Fatty acid degradation
sfc01100  Metabolic pathways
sfc01212  Fatty acid metabolism
sfc02024  Quorum sensing
sfc04146  Peroxisome
Module
sfc_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:sfc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Spiaf_1303
   00071 Fatty acid degradation
    Spiaf_1303
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Spiaf_1303
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Spiaf_1303
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sfc01004]
    Spiaf_1303
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfc04147]
    Spiaf_1303
Enzymes [BR:sfc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     Spiaf_1303
Lipid biosynthesis proteins [BR:sfc01004]
 Acyl-CoA ligase
  Long/very long chain acyl-CoA ligase
   Spiaf_1303
Exosome [BR:sfc04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   Spiaf_1303
  Exosomal proteins of breast cancer cells
   Spiaf_1303
SSDB
Motif
Pfam: AMP-binding AMP-binding_C DUF7382 S-Me-THD_C
Other DBs
NCBI-ProteinID: AFG37378
UniProt: H9UIN5
LinkDB
Position
complement(1492946..1494358)
AA seq 470 aa
MPEKWRSIFIPDASTADMLAYPSALIEGRIAGKYMLSGEALPNTAVVLGYQRNGILAGAE
VDINKDAAAKNNIDVAIMARSGRGGPKPVDTIGLQDLLKESSRKFKAVEADPDDPAVLLY
TSGTTGKPKGVTLTHRNFATQCDNAAQILPMSDKDRMVLVLPLYHVYGLANGLVTSVSMG
STMVIIPQYTPSVLLETIARTKATMLIAVPTMYMHLLQIAKVRKTAIPQSLHTCISGGAP
LAAATLQEFEDAFDTVIAEGYGLTETTSAVCLNKSGEDYKPGAIGIPAPGIEMKVVDDDG
NEVPDGTEGEIIIRGGVLTPGYWNDTASTAESIRNGWLHTGDLGYRDHDGVFFITDRKKD
LIIRGGFNISPREIEEVLYGHPGIHEAAVAAVHDKRDREMVKAFVVPAEGVSLTEQQVLD
YCRANLADYKTPKRVEFMEALPKSATGKVLRKELRGEAVDDRLIHREQKE
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgccagaaaaatggagaagtatttttattccggacgcatcaacagcggatatgctggcc
tacccctcggcgctgatcgaggggaggatcgccggcaagtacatgctgtccggcgaggca
ttgcccaataccgcggtggtgctgggataccagcgcaacggtattctggccggtgccgag
gttgacatcaacaaggatgctgcagccaaaaacaatatcgatgttgcgattatggcacgc
agcgggcgcgggggaccaaagccggtcgacaccatcggcctgcaggatctgctgaaggag
tcctcgcgaaaattcaaggcggtggaggctgatcctgacgacccggcggtattgctgtac
accagcggtacgaccggcaaacccaagggagtcaccctgacccatcgcaattttgctact
cagtgtgataacgcagcccagatcctgcccatgtccgataaggatcgcatggttctggta
ctgccgctgtaccatgtctacgggctggccaacgggctggtaacctcggtcagcatggga
tcaaccatggttatcattccgcagtacaccccgtcggtgctgctggagaccatcgccaga
accaaggcaaccatgctgattgcggttccgacgatgtacatgcatctgctgcagatagcc
aaggtccgcaagacggcaatcccgcaatcactgcacacctgtatctctggtggcgcccca
ctggcagctgccaccctgcaggagtttgaggatgcctttgatacggttattgcagagggc
tacgggcttaccgagaccacctcggcggtctgtctgaacaagtccggcgaagactacaag
cccggcgccatcggtattcctgcaccgggaatcgagatgaaggtcgtggatgatgacggc
aacgaggtgcccgacggcaccgaaggggagataatcattcgcggcggggtactgaccccg
gggtactggaatgacacagcctccaccgccgaaagcatccgcaacggctggctgcatacc
ggcgacctcgggtatcgcgaccacgacggggtattctttattaccgatcgcaagaaagac
ctgattatccgcggtggattcaacatcagtccacgcgaaatcgaagaagttctgtacgga
catcccgggatacacgaggcagcggtggcagcagtacatgacaagcgcgaccgtgaaatg
gtcaaggcctttgtggtacctgccgagggtgtcagccttaccgagcagcaggtgctggac
tactgtcgcgccaatcttgccgactacaaaacaccgaaacgggtcgagtttatggaggcg
ctgcccaagagtgcgaccggcaaggtgctgcgcaaggagcttcgcggcgaggccgttgac
gaccgcctgatacatcgcgagcagaaggagtag

DBGET integrated database retrieval system