Spirochaeta africana: Spiaf_2287 Help Entry Spiaf_2287        CDS       T01811                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sfc  Spirochaeta africana Pathway sfc01100   Metabolic pathways sfc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Spiaf_2287    00074 Mycolic acid biosynthesis     Spiaf_2287   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Spiaf_2287 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Gypsy Beta_protein Motif Other DBs NCBI-ProteinID:  AFG38320 UniProt:  H9ULC7 LinkDB All DBs Position 2588639..2588887 Genome browser AA seq 82 aa AA seqDB search MSKQEVFDKVVAIIGPFAKDEEALKGATEETNILTDLKVNSARLVDIILDFEDQFDIAID DDAADQIQTLGDAVNKILEIKG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgagcaagcaggaagtattcgacaaggtagtggccatcatcggtccgtttgccaaggat gaagaggcactgaagggtgccaccgaggagaccaacatcctcaccgatctgaaggtaaac tctgcccgactggtggacatcatcctggacttcgaggatcagtttgatatcgctatcgac gatgatgctgccgaccagattcagaccctgggcgacgcagtgaacaagatcctggagatc aagggttaa

DBGET integrated database retrieval system