Sinorhizobium fredii USDA 257: USDA257_c54470 Help Entry USDA257_c54470    CDS       T02188                                  Symbol catC Name (GenBank) muconolactone delta-isomerase 1   KO K03464   muconolactone D-isomerase [EC:5.3.3.4] Organism sfd  Sinorhizobium fredii USDA 257 Pathway sfd00362   Benzoate degradation sfd01100   Metabolic pathways sfd01120   Microbial metabolism in diverse environments sfd01220   Degradation of aromatic compounds Module sfd_M00568   Catechol ortho-cleavage, catechol => 3-oxoadipate Brite KEGG Orthology (KO) [BR:sfd00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     USDA257_c54470 (catC) Enzymes [BR:sfd01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.3  Transposing C=C bonds     5.3.3.4  muconolactone Delta-isomerase      USDA257_c54470 (catC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MIase Motif Other DBs NCBI-ProteinID:  AFL53969 UniProt:  I3XDL3 LinkDB All DBs Position complement(5663318..5663608) Genome browser AA seq 96 aa AA seqDB search MLFHVRMNVNLPLDLPAAEAAEILAREKAYSQELQRTGKWRHIWRIAGQYANYSVLDVRD NAELHEVLSGLPLFKFMDIEVTPLLRHPSAIREDDS NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgctctttcatgtgcggatgaacgtgaaccttcccctcgacctgcccgctgccgaggcg gccgagatcctcgcccgagagaaagcctattcgcaggaactgcagcgtaccggcaagtgg cggcatatctggcggatcgccggtcagtacgcgaactacagcgtccttgacgtcagggat aatgcggaattgcacgaggtactctcgggacttccgctgttcaaattcatggacatcgag gtgacgccgcttctgcggcatccctccgcgatccgtgaggacgacagctaa

DBGET integrated database retrieval system