Shigella flexneri 2002017 (serotype Fxv): SFxv_4022
Help
Entry
SFxv_4022 CDS
T01883
Symbol
yicE
Name
(GenBank) putative Xanthine/uracil permease
KO
K16345
xanthine permease XanP
Organism
sfe
Shigella flexneri 2002017 (serotype Fxv)
Brite
KEGG Orthology (KO) [BR:
sfe00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
sfe02000
]
SFxv_4022 (yicE)
Transporters [BR:
sfe02000
]
Other transporters
Electrochemical potential-driven transporters [TC:
2
]
SFxv_4022 (yicE)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Xan_ur_permease
SprB
Motif
Other DBs
NCBI-ProteinID:
ADA76001
LinkDB
All DBs
Position
3831326..3832717
Genome browser
AA seq
463 aa
AA seq
DB search
MSVSTLESENAQPVAQTQNSELIYRLEDRPPLPQTLFAACQHLLAMFVAVITPALLICQA
LGLPAQDTQHIISMSLFASGVASIIQIKAWGPVGSGLLSIQGTSFNFVAPLIMGGTALKT
GGADVPTMMAALFGTLMLASCTEMVISRVLHLARRIITPLVSGVVVMIIGLSLIQVGLTS
IGGGYAAMSDNTFGAPKNLLLAGVVLALIILLNRQRNPYLRVASLVIAMAAGYALAWFMG
MLPESNEPMTQELIMVPTPLYYGLGIEWSLLLPLMLVFMITSLETIGDITATSDVSEQPV
SGPLYMKRLKGGVLANGLNSFVSAVFNTFPNSCFGQNNGVIQLTGVASRYVGFVVALMLI
VLGLFPAVSGFVQHIPEPVLGGATLVMFGTIAASGVRIVSREPLNRRAILIIALSLAVGL
GVSQQPLILQFAPEWLKNLLSSGIAAGGITAIVLNLIFPPEKQ
NT seq
1392 nt
NT seq
+upstream
nt +downstream
nt
atgtctgtttccaccctcgagtcagaaaatgcgcaaccggttgctcagactcaaaacagc
gaactgatttaccgtcttgaagatcgtccgccgcttcctcaaaccctgtttgccgcctgt
cagcatctgctggcgatgttcgttgcggtgatcacgccagcgctattaatctgccaggcg
ctgggtttaccggcacaagacacgcaacacattattagtatgtcgctgtttgcctccggt
gtggcatcgattattcaaattaaggcctggggtccggttggctccgggctgttgtctatt
cagggcaccagcttcaactttgttgccccgctgattatgggcggtaccgcgctgaaaacc
ggtggtgctgatgttcctaccatgatggcggctttgttcggcacgttgatgctggcaagt
tgcaccgagatggtgatctcccgcgttctgcatctggcgcgccgcattattacgccgctg
gtttctggcgttgtggtgatgattatcggcctgtcgctaattcaggtggggctgacctcc
attggcggcggttacgcagccatgagcgataacaccttcggcgcaccgaaaaatctgctg
ctggcaggcgtggttttagccttaattatcctgcttaaccgtcaacgtaacccttactta
cgcgtggcctcactggtaattgcgatggcggccggatatgcgctggcgtggtttatgggc
atgttgccagaaagcaacgaaccgatgacgcaagaactgattatggtgccaacgccgctc
tattacggtcttggcattgaatggagtctgctgctgccgctgatgctggtctttatgatc
acttcgctggaaaccattggcgatatcacggcgacctctgacgtttccgaacagccagtg
tccggtccgctgtacatgaaacgcctgaaaggcggcgtgctggcaaacggcctgaactcg
tttgtttcggcggtgtttaacaccttcccgaactcctgcttcgggcaaaacaacggagtg
atccagttgactggtgttgccagccgctatgtcggttttgtcgtcgcgctgatgttgatc
gtgctgggtctgttcccggcagtgagcggttttgtacaacacattccagaaccggttctg
ggcggcgcaacgcttgtaatgtttggcaccatcgccgcctccggtgtgcgtatcgtttct
cgtgagccgctgaaccgtcgggcgattctgattatcgcgctgtcgctggcggttggtctg
ggcgtgtctcagcagccgctgattttgcagtttgcccctgaatggctgaaaaacctgctc
tcctccgggatcgccgcgggcggtattactgccatcgtgctgaatctgattttcccacca
gaaaaacagtaa
DBGET
integrated database retrieval system