Streptococcus ferus: NCTC12278_00962 Help Entry NCTC12278_00962   CDS       T07132                                  Symbol xylH Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism sfer  Streptococcus ferus Pathway sfer00362   Benzoate degradation sfer00622   Xylene degradation sfer01100   Metabolic pathways sfer01120   Microbial metabolism in diverse environments sfer01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:sfer00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     NCTC12278_00962 (xylH)    00622 Xylene degradation     NCTC12278_00962 (xylH)    00621 Dioxin degradation     NCTC12278_00962 (xylH) Enzymes [BR:sfer01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      NCTC12278_00962 (xylH) SSDB OrthologParalogGFIT Motif Pfam:  Tautomerase Tautomerase_2 DUF1904 DUF4998 Tautomerase_3 DnaB_bind Motif Other DBs NCBI-ProteinID:  SQF40394 UniProt:  A0A2X3VG12 LinkDB All DBs Position 1:936045..936230 Genome browser AA seq 61 aa AA seqDB search MPFVKIDLFEGRSEEQKIELAREVTEVVSRIAKAPKEAIHVFINDMPEGTYYPHGELKKK P NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgccatttgttaaaatcgatctttttgaaggacgttctgaggagcaaaaaatagagttg gctcgtgaggtcactgaagtcgtttcacgtatcgctaaggcccctaaagaggctattcat gtttttatcaatgatatgcctgaaggaacctactaccctcacggcgagctgaaaaagaag ccttga

DBGET integrated database retrieval system