Streptomyces ferrugineus: IM697_30955 Help Entry IM697_30955       CDS       T07428                                  Name (GenBank) acyl carrier protein   KO K21790   acyl carrier protein Organism sfeu  Streptomyces ferrugineus Pathway sfeu00333   Prodigiosin biosynthesis sfeu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfeu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00333 Prodigiosin biosynthesis     IM697_30955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  QOV34517 UniProt:  A0A7M2SDU7 LinkDB All DBs Position 6897347..6897595 Genome browser AA seq 82 aa AA seqDB search MSAMYGRLVGLLVDRFEVNRAEIGPDTTFEDLDMDSLFLVELLLVIQSEFGVHIDDDAAS PGDTISQVADLLERHTTSPASS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgatgtacggcaggctggtcggccttctcgtcgaccgtttcgaggtgaaccgc gccgagatcggcccggacaccacgttcgaggacctcgacatggactccctgttcctggtg gaactgctcctggtgatccagtcggagttcggcgtgcacatcgacgacgacgccgcctcg cccggcgacacgatcagccaggtcgccgatctgctggaacggcacaccacctccccggcc tcgtcatga

DBGET integrated database retrieval system