KEGG   Streptomyces ferrugineus: IM697_30980
Entry
IM697_30980       CDS       T07428                                 
Name
(GenBank) RedV protein
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
sfeu  Streptomyces ferrugineus
Pathway
sfeu00333  Prodigiosin biosynthesis
sfeu01100  Metabolic pathways
sfeu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfeu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    IM697_30980
SSDB
Motif
Pfam: Nitroreductase
Other DBs
NCBI-ProteinID: QOV34521
UniProt: A0A7M2SH47
LinkDB
Position
6901053..6902309
AA seq 418 aa
MTSTSPSQSAPANRGVAFQDALQAAAEIAAYSPSSHNCQPWGVGWAIGAAARHTAVALLA
DTAEQTGAGCGPAARNEVEYLVLALDRARQLTALSSHGVEMLVSCGAYGEILLRALAAQG
WRADRVRFVDPAPAAHGLKDDDPDRIFGGRWPRAWMPLCVVRLSHAPTPSGDLAELRDTV
RARHTNRGPYRPDRIEPAVLAGLSTTRSGLSLFRAAPGGDSEVTVRHVVADAERAAVGDL
VSRHGGRDFSHRAAWRETHSFIRRDEADAETSGDGFTLGQLFGPMSPPRRFGMRIALAPV
TMRILRHVGYHRILARQLAAMVRCSPAAVALCFDDGAPGAESVVRGGAVLADYWLGATRA
GLVLHPVSVILQHDDVRAELEQRLGLPGRAFFVSRLGHAVTAFPPSRRLAASHALRLV
NT seq 1257 nt   +upstreamnt  +downstreamnt
gtgacatcgacatccccctcccagtccgctcccgcgaaccggggcgtagcgttccaggac
gcgctccaggcggcggccgagatcgccgcctacagtccgtcctcgcacaactgccagccc
tggggcgtcggttgggcgatcggcgcggccgctcggcacaccgcggtggcactgctcgcg
gacactgccgagcagaccggagccggctgcggtcccgccgcgcggaacgaggtcgagtat
ctggtcctcgccctcgaccgcgcacggcagctcacggcgctctcctcgcacggggtcgag
atgctggtcagctgcggcgcgtacggagagatcctgctgcgggccctggccgcccagggc
tggcgggccgaccgggtccgcttcgtcgacccggccccagcggcccacgggctgaaggac
gacgaccccgaccggatcttcggtggccgatggccgcgtgcctggatgccgctgtgcgtt
gtccggctgtcacacgcgcccaccccctcgggtgacctcgccgagctgcgcgacaccgtg
cgcgcccggcacaccaaccggggcccctaccgtcccgacaggatcgagcccgccgtgctg
gcgggactgtcgacgacacgatcggggctttcgctgttccgggcggcaccggggggcgac
tcagaggtcaccgtccgccatgtggtggccgatgccgagcgcgccgcggtcggcgacctc
gtctctcggcacggcgggcgcgacttcagccaccgtgccgcctggcgggagacgcactcg
ttcatacgccgcgacgaggccgacgccgagaccagcggtgacggcttcactctcggtcag
ctcttcggaccgatgtcgccgccgcgtcgattcgggatgcggatcgccctggcacccgtg
accatgcggatcctgcggcacgtgggctaccaccggatcctcgctcgccaactcgccgcc
atggtgcggtgctctcccgccgccgtcgccctgtgcttcgacgacggggcacccggcgcc
gagtccgtcgtccgcggcggcgccgttctggccgactactggctcggcgcgacccgcgcc
ggactggtcctgcatcccgtgagcgtcatcctccagcacgacgatgtccgggccgagttg
gagcaacggctcggcctgcccgggcgggcgttcttcgtgagcagactgggacatgcggtc
acggcattcccgccgtcgcgccgactcgcagcgtcccacgcactgcgactcgtttga

DBGET integrated database retrieval system