Streptomyces ferrugineus: IM697_36525 Help Entry IM697_36525       CDS       T07428                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism sfeu  Streptomyces ferrugineus Pathway sfeu00190   Oxidative phosphorylation sfeu01100   Metabolic pathways Module sfeu_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sfeu00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     IM697_36525 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sfeu00194]     IM697_36525 (atpE) Photosynthesis proteins [BR:sfeu00194]  Photosystem and electron transport system   F-type ATPase [OT]    IM697_36525 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QOV35515 UniProt:  A0A7M2SIF3 LinkDB All DBs Position complement(8207020..8207253) Genome browser AA seq 77 aa AA seqDB search MSQTLAAVTGSLGSIGYGLAAIGPGVGVGIIFGNGTQALARQPEAAGLIRANQILGFAFC EALALIGLVMPFVYGYN NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtcccagacccttgccgccgttaccggctcgctcggctccatcggttacggcctcgct gccattggccccggcgtcggcgtcggcatcatcttcggtaacggcacccaggctcttgcc cgtcagcccgaggccgccggcctgatccgtgccaaccagatcctcggcttcgccttctgt gaggcgctcgccctgatcggtctggttatgccgttcgtctacggctacaactaa

DBGET integrated database retrieval system