Streptomyces ferrugineus: IM697_37545 Help Entry IM697_37545       CDS       T07428                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism sfeu  Streptomyces ferrugineus Pathway sfeu00253   Tetracycline biosynthesis sfeu01056   Biosynthesis of type II polyketide backbone sfeu01100   Metabolic pathways sfeu01110   Biosynthesis of secondary metabolites Module sfeu_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:sfeu00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     IM697_37545    00253 Tetracycline biosynthesis     IM697_37545  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:sfeu01004]     IM697_37545    01008 Polyketide biosynthesis proteins [BR:sfeu01008]     IM697_37545 Lipid biosynthesis proteins [BR:sfeu01004]  Polyketide synthase   Component type    IM697_37545 Polyketide biosynthesis proteins [BR:sfeu01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      IM697_37545     Nonaketide PKS      IM697_37545     Decaketide PKS      IM697_37545 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  QOV35696 UniProt:  A0A7M2SH73 LinkDB All DBs Position complement(8447883..8448161) Genome browser AA seq 92 aa AA seqDB search MTATTETITVTLADLTRMLRESAGEEEGVDLDGDVIDTPFIELGYDSLALLQVIGQIQRE YGIVIPDDAVVDAETPGMLLALINAGDTPAAA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaccgccaccaccgagaccatcaccgtcaccctcgccgacctgacccgcatgctgcgc gagagcgcgggcgaggaggagggcgtcgacctggacggcgacgtcatcgacacccccttc atcgagctcggctacgactcgctcgccctcttgcaggtcatcggccagatacagcgcgag tacgggatcgtgatcccggacgacgccgtcgtcgacgccgagaccccgggcatgctgctc gcgctcatcaacgccggcgacaccccggcagccgcctga

DBGET integrated database retrieval system