KEGG   Streptomyces ferrugineus: IM697_37620
Entry
IM697_37620       CDS       T07428                                 
Name
(GenBank) aromatase/cyclase
  KO
K15885  C7-C12 aromatase (ARO/CYC) [EC:4.2.1.-]
Organism
sfeu  Streptomyces ferrugineus
Pathway
sfeu01056  Biosynthesis of type II polyketide backbone
sfeu01100  Metabolic pathways
sfeu01110  Biosynthesis of secondary metabolites
Module
sfeu_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:sfeu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    IM697_37620
Enzymes [BR:sfeu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-
     IM697_37620
SSDB
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc Rbx_binding
Other DBs
NCBI-ProteinID: QOV35711
UniProt: A0A7M2SKH0
LinkDB
Position
complement(8465094..8466080)
AA seq 328 aa
MATAVSDTSATKVTEHSVSVAAPPADVYRLVADVSAWPQVFGPTVHVEVLQEADPERGGE
QTLRIWATAEGRVKAWTSRRVLDPAARTVVFRQVVSAPPVASMGGEWRVEEQSDGTTRVV
LLHDYRAVGDDPEAEALIARAVDRNSNAELAALKNAAELGANGDELRMTFSDSETVHGDA
ADVYAFLARAELWPERLPHVARLDLAEEEGGVQRMDMDTRSPDGSLHNTTSIRVLFEDRR
EIVYKQLRVPVAMSGHTGRWEIETLGDGTVRATSWHTVTLDPEGIRSALGPDATVGEARD
LVRGALGGNSSTTLRHARRFAEEARART
NT seq 987 nt   +upstreamnt  +downstreamnt
gtggctaccgcagtgtccgacacatcggcgaccaaggtcacggaacactccgtcagcgtc
gccgcgccgccggccgacgtctaccggctcgtcgcggacgtctccgcgtggccgcaggtc
ttcgggccgaccgtgcatgtcgaggtcctccaggaggccgaccccgagcgcggcggcgag
cagacgctgcggatctgggccacggccgagggccgggtcaaggcgtggacctcgcgccgc
gtcctcgaccccgccgcccgcaccgtcgtcttccgccaggtcgtctccgccccgccggtc
gcctccatgggcggcgagtggcgcgtcgaggagcagagcgacggcaccacccgcgtcgtc
ctgctgcacgactaccgtgccgtcggcgacgacccggaggccgaggccctgatcgcccgt
gccgtggaccgcaacagcaacgccgagctggccgccctgaagaacgccgccgaactcggc
gcgaacggcgacgaactgcgcatgaccttctccgactcggagaccgtccacggcgacgcg
gccgacgtctacgccttcctcgcgcgcgccgagctgtggcccgagcggctgccgcacgtc
gcccgcctcgacctcgccgaggaggagggcggcgtccagcgcatggacatggacacccgc
agcccggacggctccctgcacaacaccacctcgatcagggtcctgttcgaggaccgccgg
gagatcgtctacaaacagctgcgggtgccggtcgcgatgagcgggcacaccggacgctgg
gagatcgagacactcggcgacggcaccgtgcgggccacctcctggcacacggtgaccctg
gacccggagggcatccgcagcgccctcggccccgacgccaccgtcggggaggctcgcgac
ctggtgcgcggggcactgggcggcaacagctcgaccaccctgcgccacgcccgtcgattc
gcggaggaagcacgtgcccgaacgtga

DBGET integrated database retrieval system