Serratia fonticola GS2: AV650_04200 Help Entry AV650_04200       CDS       T04716                                  Name (GenBank) tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism sfg  Serratia fonticola GS2 Pathway sfg00362   Benzoate degradation sfg00621   Dioxin degradation sfg00622   Xylene degradation sfg01100   Metabolic pathways sfg01120   Microbial metabolism in diverse environments sfg01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:sfg00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     AV650_04200    00622 Xylene degradation     AV650_04200    00621 Dioxin degradation     AV650_04200 Enzymes [BR:sfg01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      AV650_04200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 CinA_KH AAA_22 Tautomerase_3 Motif Other DBs NCBI-ProteinID:  ALX92804 UniProt:  A0A0U3S826 LinkDB All DBs Position complement(916303..916506) Genome browser AA seq 67 aa AA seqDB search MPYVNIKITREGATAEQKKQLIAGVTQLLVDTLGKNPATTVVVIDEVETDNWGIGGQCVT DLRAAAK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgccctacgtaaatatcaaaattacccgcgaaggcgcaaccgcggagcagaaaaaacag ctaattgcaggcgtgacccaactgttggtcgatacgctcggcaaaaatccggccactacc gtggtggttatagatgaagtggaaaccgataactgggggattggtggtcaatgtgtcacc gatctgcgcgcggcggccaagtag

DBGET integrated database retrieval system