Serratia fonticola GS2: AV650_14650 Help Entry AV650_14650       CDS       T04716                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sfg  Serratia fonticola GS2 Pathway sfg01100   Metabolic pathways sfg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AV650_14650    00074 Mycolic acid biosynthesis     AV650_14650   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AV650_14650 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  ALX94717 UniProt:  A0A0F7HFI5 LinkDB All DBs Position 3214797..3215033 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKQEEVLNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFINASQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcattgttgagcaactgggtgttaagcag gaagaagtattgaacaacgcttctttcgttgaagacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagaattcgacaccgaaattccagacgaagaagct gagaaaatcactactgtgcaagcagctattgatttcatcaacgctagccagcagtaa

DBGET integrated database retrieval system