Serratia fonticola GS2: AV650_20875 Help Entry AV650_20875       CDS       T04716                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sfg  Serratia fonticola GS2 Pathway sfg01100   Metabolic pathways sfg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AV650_20875    00074 Mycolic acid biosynthesis     AV650_20875   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AV650_20875 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ALX95842 UniProt:  A0AAW3WJF0 LinkDB All DBs Position 4535984..4536241 Genome browser AA seq 85 aa AA seqDB search MQALHLEIKNLIINTLNLDELSADDIDTNAALFGEGLGLDSIDALELGLMVKNQYGVALS AENEEMRQHFYSVATLASFIQAQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctccaccttgaaattaaaaatctcataataaatacactgaatttggatgaa ctgtctgcggacgatatcgacaccaatgcggcgctgtttggtgaaggattggggctggac tccatcgatgctttagagttagggctgatggttaaaaaccagtatggtgtcgcgctttcc gccgaaaatgaagagatgcgtcaacatttctactcagtggcaacactggcatcctttatc caagctcaacgtgcctga

DBGET integrated database retrieval system