Streptomyces microflavus: SFUL_1972 Help Entry SFUL_1972         CDS       T02650                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism sfi  Streptomyces microflavus Pathway sfi00998   Biosynthesis of various antibiotics sfi01100   Metabolic pathways sfi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SFUL_1972    00074 Mycolic acid biosynthesis     SFUL_1972   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SFUL_1972 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AGK76935 UniProt:  N0CMV7 LinkDB All DBs Position 2217287..2217535 Genome browser AA seq 82 aa AA seqDB search MAATQEEIVTGLAEIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDAADYILKHQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccacgcaggaagagatcgtcaccggtctcgccgagatcgtcaacgagatcgcc gggatcccggtcgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgacgtcaagatcccc gacgaggacgtcaagaacctcaagacggtcggcgacgctgccgactacatcctgaagcac cagggctga

DBGET integrated database retrieval system