KEGG   Streptomyces ficellus: EIZ62_06155
Entry
EIZ62_06155       CDS       T06929                                 

Name
(GenBank) inosamine-phosphate amidinotransferase 1
  KO
K04340  scyllo-inosamine-4-phosphate amidinotransferase 1 [EC:2.1.4.2]
Organism
sfic  Streptomyces ficellus
Pathway
sfic00521  Streptomycin biosynthesis
sfic01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfic00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EIZ62_06155
Enzymes [BR:sfic01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.4  Amidinotransferases
    2.1.4.2  scyllo-inosamine-4-phosphate amidinotransferase
     EIZ62_06155
SSDB
Motif
Pfam: ADI
Other DBs
NCBI-ProteinID: QGV77876
UniProt: A0A1W5T2I3
LinkDB
Position
1387224..1388264
AA seq 346 aa
MSLVNVHTEWDPLEEIVVGTMEGARMPIVDRSLLATEFPDIDDPQQIPTGLYPAQVAEET
EAELEALADLLTGLGVTVRRPGGRDHKSIVSTPDWSTDGFYDYCPRDGFLAVGDAIIESP
MVLRSRWLEGFAYKDLFLEYSDSGARWLSAPKPQLTDDMYEPTAPPGQRLRDLEPAFDAA
NILRFGTDLLYQVSDSGNKRGARWLQSVLGPQYTVHPCENLYTSTHIDSTIVPLRPGLLL
VNPARVTEDNFPDFLRGWDRIVCPELVDTGFVGDHPKSSVWIGMNFLVIAPGKAIVDKRQ
TGLIRELERHGVEVIPSQLTHSRTLGGGFHCVTLDVRRAGELATYR
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgagcctggtcaatgtccacacggaatgggacccgctcgaagaaatcgtcgtagggacc
atggaaggcgcacggatgccgatcgtcgatcggagcctgctcgccacggaattcccggac
atagacgacccacaacagattccgaccggcctttatcccgcccaggtggccgaggagacc
gaggccgagctcgaagcgctggccgacctgctcaccggcctcggcgtgaccgtacgacgg
cccggcggacgtgaccacaagtcgatcgtctccacaccggactggagcaccgacggcttc
tacgactactgcccccgggacggcttcctcgccgtcggcgacgcgatcatcgagtccccc
atggtgctgcggtcccggtggctcgaagggttcgcctacaaggacctgttcctggagtac
tcggacagcggtgcccgctggctgtcggcgcccaagccccagctgaccgacgacatgtac
gagccgaccgccccgccgggacagcgcctgcgggacctggaaccggccttcgacgcggcc
aatatcctcaggttcggtacggacctgctctaccaggtgtccgacagcggcaacaagcgc
ggcgcacggtggctccagtcggtgctcgggccgcagtacacggtgcacccctgcgagaac
ctgtacacgtccacccacatcgactcgaccatcgtgccgctgcgccccgggctcctgctg
gtcaaccccgcccgggtcaccgaggacaacttcccggacttcctgcgcggttgggaccgg
atcgtctgcccggagctggtggacaccggcttcgtcggcgaccacccgaagtcatccgtc
tggatcgggatgaacttcctggtgatcgcgcccggcaaggccatcgtcgacaagcgccag
acggggctcatccgcgagctggagcgccacggagtggaggtgatcccgtcgcagctcacc
cactccaggaccctcggcggtggtttccactgcgtcacgctcgacgtgcgccgcgcgggc
gaactcgccacctaccggtag

DBGET integrated database retrieval system