KEGG   Streptomyces finlayi: F0344_12240
Entry
F0344_12240       CDS       T09573                                 
Name
(GenBank) aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sfiy  Streptomyces finlayi
Pathway
sfiy00220  Arginine biosynthesis
sfiy00250  Alanine, aspartate and glutamate metabolism
sfiy00290  Valine, leucine and isoleucine biosynthesis
sfiy01100  Metabolic pathways
sfiy01110  Biosynthesis of secondary metabolites
sfiy01210  2-Oxocarboxylic acid metabolism
sfiy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sfiy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    F0344_12240
   00290 Valine, leucine and isoleucine biosynthesis
    F0344_12240
   00220 Arginine biosynthesis
    F0344_12240
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sfiy01007]
    F0344_12240
Enzymes [BR:sfiy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     F0344_12240
    2.6.1.66  valine---pyruvate transaminase
     F0344_12240
Amino acid related enzymes [BR:sfiy01007]
 Aminotransferase (transaminase)
  Class I
   F0344_12240
SSDB
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase Aminotran_3 MTTB
Other DBs
NCBI-ProteinID: QNE75278
UniProt: A0A7G7BIW3
LinkDB
Position
2715725..2716936
AA seq 403 aa
MQVIQSTKLSGVCYEIRGPVLEEAMRLEAAGHRILKLNTGNPAAFGFECPPEILEDILRN
LSGAHGYGDAKGLLSARRAVVQHYQTKAIDLDVEDVYLGNGVSELIQMSMQALLDDGDEV
LVPAPDYPLWTASVSLAGGTAVHYRCDEQADWMPDLADIERKITDRTKALVIINPNNPTG
AVYDDEMLRGLTEIARRHQLVVCSDEIYDRILYDGATHTPTAAIAPDLMVLTFNGLSKNY
RVAGFRSGWLAVCGPKAHASSYIEGLTILANMRLCANMPSQHAVATALGGRQSINDLVLP
GGRILEQRDVAYDLLTQIPGVTCVKPKGALYLFPRLDPKVYKIKDDRQMVLDLLRAEKIM
VVHGTGFNWPEPDHFRIVTLPPTKDLVAAVTRIGNFLDGYSQP
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgcaggtcatccagtccacgaagctctccggcgtctgttacgaaatccggggtccggtg
ctcgaggaggcgatgcggctggaagcagcaggtcaccgcatcctcaagctcaacaccggc
aaccccgccgcgttcggattcgagtgcccgcccgagattctcgaagacatactgcgcaac
ctctccggggcgcacggctacggcgacgcgaagggcctgctgtcggcgcgccgcgcggtg
gtgcagcactaccagaccaaggcgatcgacctcgacgtcgaggacgtctacctcggcaac
ggcgtctccgagctgatccagatgtcgatgcaggcgctgctcgacgacggcgacgaggtg
ctcgtacccgctccggactatccgctgtggaccgcctcggtctccctggccggcggcacg
gctgtgcactaccggtgcgacgagcaggcggactggatgcccgacctcgccgacatcgag
cggaagatcaccgaccgcaccaaggccctggtgatcatcaacccgaacaacccgaccggc
gcggtgtacgacgacgagatgctgcgcgggctgacggagatcgcccggcgccaccagttg
gtcgtctgctccgacgagatctacgaccgcatcctgtacgacggcgcgacgcacaccccg
acggccgcgatcgcccccgatctgatggtgctgaccttcaacgggctgtcgaagaactac
cgggtcgccggtttccggtccggctggctggcggtctgcggcccgaaggcgcacgcctcc
tcgtacatcgaggggctgacgatcctcgccaacatgcggctgtgcgccaacatgccctcg
cagcacgcggtggccacggcgctcggcggccgtcagtcgatcaacgatctggtgctgccg
ggcgggcggatcctggagcagcgggacgtggcgtacgacctgctgacgcagatccccggg
gtgacgtgcgtgaagcccaagggggcgctgtacctcttcccccggctggacccgaaggtc
tacaagatcaaggacgaccggcagatggtgctggatctgctgcgggccgagaagatcatg
gtggtgcacggcacggggttcaactggcccgaacccgatcacttccggatcgtgacgctg
ccgccgacgaaggacctggtcgccgcggtgaccaggatcgggaacttccttgacggctac
agccagccgtag

DBGET integrated database retrieval system