Serratia ficaria: SAMEA4384070_4147
Help
Entry
SAMEA4384070_4147 CDS
T06444
Symbol
yggS
Name
(GenBank) Predicted enzyme with a TIM-barrel fold
KO
K06997
PLP dependent protein
Organism
sfj
Serratia ficaria
Brite
KEGG Orthology (KO) [BR:
sfj00001
]
09190 Not Included in Pathway or Brite
09191 Unclassified: metabolism
99985 Amino acid metabolism
SAMEA4384070_4147 (yggS)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ala_racemase_N
Motif
Other DBs
NCBI-ProteinID:
SNW05034
UniProt:
A0A240CAP3
LinkDB
All DBs
Position
1:4402010..4402717
Genome browser
AA seq
235 aa
AA seq
DB search
MSTIQQNLQDVRNRIASAARDCARAPEEITLLAVSKTKPVAAIAEAIAAGQRAFGENYVQ
EGVDKIQHFAASPQAAWLEWHFIGPLQSNKSRLVAEHFAWCHTLDRLRIAQRLSDQRPAE
MAPLNVLIQINISDEQSKSGIVLDELPALAEAIAALPNLRLRGLMAIPAPEDDYPRQLAV
FGRMNDAFLALRQRYPQVDTLSMGMTDDMAAAIAAGSTLVRIGTAIFGARDYSPA
NT seq
708 nt
NT seq
+upstream
nt +downstream
nt
atgagcactattcaacagaacctgcaggatgtcagaaaccgcattgcgtcggccgctcga
gactgcgcgcgcgcgccagaagaaattaccctgcttgccgtcagcaaaaccaaacctgtg
gcggcgatcgcagaagccatcgccgccggccaacgggcgtttggtgaaaactacgtgcag
gaaggggtcgataaaattcagcatttcgccgcgtcgccgcaggccgcctggctggaatgg
cactttatcggcccgctgcaatccaataagagccggctggtggcggagcacttcgcctgg
tgccacacgctggaccggctgcgcatcgcccagcgcctgagcgatcagcgcccggcagag
atggccccgcttaacgtgctgatccaaataaatatcagcgacgagcagagtaaatctggc
attgtactggatgagctgccggcgctggccgaggcgatcgccgccctgcccaatctgagg
ttgcgcgggctgatggccattcctgcgccggaagacgattacccgcggcagctggcggtg
ttcggccgcatgaacgacgctttcctggcgctgcggcagcgctacccgcaggttgatacg
ctgtcgatgggcatgaccgacgacatggcggcggccatcgccgcgggcagcaccctggtg
cgtatcggcaccgcaatttttggcgcccgtgattactcaccggcctga
DBGET
integrated database retrieval system