Streptomyces formicae: KY5_0607c Help Entry KY5_0607c         CDS       T05416                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism sfk  Streptomyces formicae Pathway sfk00998   Biosynthesis of various antibiotics sfk01100   Metabolic pathways sfk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KY5_0607c    00074 Mycolic acid biosynthesis     KY5_0607c   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KY5_0607c BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ATL25625 UniProt:  A0A291Q2A9 LinkDB All DBs Position complement(720847..721089) Genome browser AA seq 80 aa AA seqDB search MSVDQEILVQVQNIVAFLSERPVDDVRPDHRLLEDLDLDSLKITELAQKLENALGKPIDD DLLNADGTTVARCAEIAECA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt gtgtccgtcgatcaagaaattctggtgcaagtgcagaacattgttgccttcctcagcgag cggccggtcgatgacgtcaggccggaccacaggctgctggaggatcttgatctcgactcc ctcaaaattacggagctggcgcagaagctcgagaacgcgttgggcaagcccatcgacgac gacttgctcaacgcggatggcacgaccgtcgcccgctgcgccgagatcgccgaatgcgct tag

DBGET integrated database retrieval system