Streptomyces formicae: KY5_0654c Help Entry KY5_0654c         CDS       T05416                                  Name (GenBank) Polymyxin synthetase PmxB   KO K05375   MbtH protein Organism sfk  Streptomyces formicae Pathway sfk00261   Monobactam biosynthesis sfk01100   Metabolic pathways sfk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KY5_0654c  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sfk01008]     KY5_0654c Polyketide biosynthesis proteins [BR:sfk01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KY5_0654c BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2278 Motif Other DBs NCBI-ProteinID:  ATL25672 UniProt:  A0A291Q258 LinkDB All DBs Position complement(779753..779974) Genome browser AA seq 73 aa AA seqDB search MSTNPFEDAEGTYLVLVNDEGQHSLWPSFVEVPAGWLVALKETNRQAALDYVNENWTDMR PKSLIDAMEKADA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaacccgttcgaggacgccgaaggcacctacctggtcctggtcaacgacgag ggccagcactccctttggccgtcgttcgtcgaggtaccggccggatggctggtcgccctg aaggagacgaaccgccaggcggcgctcgactacgtcaacgagaactggaccgacatgcgg cccaagagcctgatcgacgccatggagaaggccgacgcctga

DBGET integrated database retrieval system