Streptomyces formicae: KY5_3453 Help Entry KY5_3453          CDS       T05416                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism sfk  Streptomyces formicae Pathway sfk00998   Biosynthesis of various antibiotics sfk01100   Metabolic pathways sfk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KY5_3453    00074 Mycolic acid biosynthesis     KY5_3453   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KY5_3453 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  ATL28471 UniProt:  A0A291Q9U1 LinkDB All DBs Position 4119153..4119443 Genome browser AA seq 96 aa AA seqDB search MTRALPGHSWKELPMSSLHDEIVQRLSDALGIKKSLITPDVTFVELKIDSLALVEFSVIL DEEYGVPPLQLTPDSTIGDAVALVDAALGAPTEASS NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgacgcgcgccctgcccggccattcttggaaggaactcccgatgtccagccttcatgac gagatcgttcagcggctttcggatgcactgggcatcaagaagtcgctcatcacccccgac gtgaccttcgtcgagctcaagatcgactcgttggcgctcgtcgagttctcggtgatcctc gacgaggagtacggcgttccgccgctgcagctaacgccggacagcaccatcggggatgcc gtggccctcgtggacgccgcgctcggcgcgccgaccgaggcctcctcgtga

DBGET integrated database retrieval system