KEGG   Shigella flexneri 301 (serotype 2a): CP0125
Entry
CP0125            CDS       T00097                                 
Symbol
ipaA
Name
(RefSeq) hypothetical protein
  KO
K13284  invasin A
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
sfl05100  Bacterial invasion of epithelial cells
sfl05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:sfl00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    CP0125 (ipaA)
   05100 Bacterial invasion of epithelial cells
    CP0125 (ipaA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sfl04812]
    CP0125 (ipaA)
Cytoskeleton proteins [BR:sfl04812]
 Prokaryotic cytoskeleton proteins
  Actin homologs
   Actin-binding proteins
    CP0125 (ipaA)
SSDB
Motif
Pfam: SipA SipA_VBS
Other DBs
NCBI-GeneID: 1238056
NCBI-ProteinID: NP_858258
UniProt: P18010
Structure
LinkDB
Position
pCP301:complement(107178..109079)
AA seq 633 aa
MHNVNNTQAPTFLYKATSPSSTEYSELKSKISDIHSSQTSLKTPASVSEKENFATSFNQK
CLDFLFSSSGKEDVLRSIYSNSMNAYAKSEILEFSNVLYSLVHQNGLNFENEKGLQKIVA
QYSELIIKDKLSQDSAFGPWSAKNKKLHQLRQNIEHRLALLAQQHTSGEALSLGQKLLNT
EVSSFIKNNILAELKLSNETVSSLKLDDLVDAQAKLAFDSLRNQRKNTIDSKGFGIGKLS
RDLNTVAVFPELLRKVLNDILEDIKDSHPIQDGLPTPPEDMPDGGPTPGANEKTSQPVIH
YHINNDNRTYDNRVFDNRVYDNSYHENPENDAQSPTSQTNDLLSRNGNSLLNPQRALVQK
VTSVLPHSISDTVQTFANNSALEKAFNHTPDNSDGIGSDLLTTSSQERSANNSLSRGHRP
LNIQNSSTTPPLHPEGVTSSNDNSSDTTKSSASLSHRVASQINKFNSNTDSKVLQTDFLS
RNGDTYLTRETIFEASKKVTNSLSNLISLIGTKSGTQERELQEKSKDITKSTTEHRINNK
LKVTDANIRNYVTETNADTIDKNHAIYEKAKEVSSALSKVLSKIDDTSAELLTDDISDLK
NNNDITAENNNIYKAAKDVTTSLSKVLKNINKD
NT seq 1902 nt   +upstreamnt  +downstreamnt
atgcataatgtaaataatactcaagcgccaacattcttatataaggcaacttcaccatca
tcaacagaatacagcgagttaaaaagcaaaatatccgatatccatagttcgcaaacttct
ctaaaaacaccagcatcagtgtctgaaaaagaaaactttgcaacgtcttttaatcagaaa
tgtcttgattttttattttcttcctcagggaaagaagatgtgttaagaagcatttattcc
aactcaatgaatgcgtatgccaaaagcgagattctcgaattttcaaatgttttgtactcc
ttagtacatcaaaatggtcttaattttgaaaacgaaaagggacttcaaaaaattgtcgca
cagtattcggaactaattataaaagataaattatcccaagattctgcctttggaccatgg
tcggcaaagaataagaaactccatcaattacgacaaaacattgagcacagacttgcacta
ttagcacaacaacacacatctggtgaagctttatcattgggacaaaaactcctcaatact
gaagtatcatcatttatcaagaataatattcttgctgaattaaagttaagtaatgaaact
gtttcatctctcaaactagatgatttagttgacgcacaggcaaaacttgcctttgatagt
ttgcgcaatcaacgtaaaaatactattgatagtaaaggatttggtataggtaaactgtca
agagacttaaatacagtagccgtgtttcctgagctgttgagaaaagtccttaatgatatt
ttagaagatataaaagattcgcatcctatccaagatggcctccctacacctcccgaagat
atgccagatggcggaccaacccccggagccaatgagaaaacatcccaacctgtaattcac
tatcatataaataatgataatagaacttacgataatagagtttttgacaacagagtatat
gacaatagctatcacgagaacccagaaaatgatgcacagtctcctacttctcagacaaac
gatctattatcccgtaacggaaactcattactaaatccacaaagagcactagttcaaaaa
gtaacttccgttctaccacactctatatcagatactgtccagacatttgcaaataattca
gctttagaaaaggctttcaaccatactccagataattcggatggaataggttcagacctg
ttaactacgagtagtcaagaaagatctgcaaataactctctttctcggggacacaggcct
ctgaacatacagaactcttcaaccaccccccctctccacccggaaggagtgacaagcagt
aatgataactcatcagatacaactaaaagtagcgcttctctttctcatagagtagcttcg
caaatcaataaattcaactcaaacactgattcaaaagtacttcagactgattttttatca
agaaatggagacacatatttaacacgggaaacgatatttgaagcttcaaaaaaagtaaca
aactccctaagtaatcttatatctctcattggaactaaatcaggaacacaagaacgagag
ttacaggaaaaatcaaaggacattacaaaatccacaacagaacatagaataaacaacaaa
ttaaaagttacagatgcaaatataagaaactacgtaacagaaaccaacgcagatacaatt
gataaaaatcatgcgatctatgaaaaggcaaaagaagtatctagcgccctcagcaaggta
ttgtcaaaaattgacgatacctctgcagaattacttacagatgatatatctgatttaaaa
aataacaatgatattacagctgaaaacaataatatatataaagcagcaaaagatgtaacc
acttccctatcaaaagtattaaagaatatcaataaggattaa

DBGET integrated database retrieval system