KEGG   Shigella flexneri 301 (serotype 2a): CP0126
Entry
CP0126            CDS       T00097                                 
Symbol
ipaD
Name
(RefSeq) hypothetical protein
  KO
K13287  invasin D
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
sfl05100  Bacterial invasion of epithelial cells
sfl05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:sfl00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    CP0126 (ipaD)
   05100 Bacterial invasion of epithelial cells
    CP0126 (ipaD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfl02000]
    CP0126 (ipaD)
Transporters [BR:sfl02000]
 Other transporters
  Pores ion channels [TC:1]
   CP0126 (ipaD)
SSDB
Motif
Pfam: T3SS_TC Filament CHASE3 HEPPP_synt_1 DUF4515
Other DBs
NCBI-GeneID: 1238053
NCBI-ProteinID: NP_858259
UniProt: P18013
Structure
LinkDB
Position
pCP301:complement(109088..110086)
AA seq 332 aa
MNITTLTNSISTSSFSPNNTNGSSTETVNSDIKTTTSSHPVSSLTMLNDTLHNIRTTNQA
LKKELSQKTLTKTSLEEIALHSSQISMDVNKSAQLLDILSRHEYPINKDARELLHSAPKE
AELDGDQMISHRELWAKIANSINDINEQYLKVYEHAVSSYTQMYQDFSAVLSSLAGWISP
GGNDGNSVKLQVNSLKKALEELKEKYKDKPLYPANNTVSQEQANKWLTELGGTIGKVSQK
NGGYVVSINMTPIDNMLKSLDNLGGNGEVVLDNAKYQAWNAGFSAEDETMKNNLQTLVQK
YSNANSIFDNLVKVLSSTISSCTDTDKLFLHF
NT seq 999 nt   +upstreamnt  +downstreamnt
atgaatataacaactctgactaatagtatttccacctcatcattcagtccaaacaatacc
aacggttcatcaaccgaaacagttaattctgatataaaaacaacgaccagttctcatcct
gtaagttcccttactatgctcaacgacacccttcataatatcagaacaacaaatcaggca
ttaaagaaagagctttcacaaaaaacgttgactaaaacatcgctagaagaaatagcatta
cattcatctcagattagcatggatgtaaataaatccgctcaactattggatattctttcc
aggcacgaatatccaattaataaagacgcaagagaattattacattcagctccgaaagaa
gccgagcttgatggagatcaaatgatatctcatagagaactgtgggctaaaattgcaaac
tccatcaatgatattaatgaacagtatctgaaagtatatgaacatgccgttagttcatat
actcaaatgtatcaagattttagcgctgttctttccagtcttgccggctggatctctccc
ggaggtaacgacggaaactccgtgaaattacaagtcaactcgcttaaaaaggcattggaa
gaactcaaggaaaaatataaagataaaccgctatatccagcaaataatactgttagtcag
gaacaagcaaataaatggcttacagaattaggtggaacaatcggcaaggtatctcaaaaa
aacgggggatatgttgtcagtataaacatgaccccaatagacaatatgttaaaaagctta
gataatctaggtggaaatggcgaggttgtgctagataatgcaaaatatcaggcatggaat
gccggattctctgccgaagatgaaacaatgaaaaataatcttcaaactttagttcaaaaa
tacagtaatgccaatagtatttttgataatttagtaaaggttttgagtagtacaataagc
tcatgtacagatacagataaactttttctccatttctga

DBGET integrated database retrieval system