KEGG   Shigella flexneri 301 (serotype 2a): CP0127
Entry
CP0127            CDS       T00097                                 
Symbol
ipaC
Name
(RefSeq) IpaC, secreted by the Mxi-Spa secretion machinery, required for entry into epithelial cells
  KO
K13286  invasin C
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
sfl05100  Bacterial invasion of epithelial cells
sfl05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:sfl00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    CP0127 (ipaC)
   05100 Bacterial invasion of epithelial cells
    CP0127 (ipaC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sfl04812]
    CP0127 (ipaC)
Cytoskeleton proteins [BR:sfl04812]
 Prokaryotic cytoskeleton proteins
  Actin homologs
   Actin-binding proteins
    CP0127 (ipaC)
SSDB
Motif
Pfam: IpaC_SipC RNA_pol_Rpb2_45 VIT1
Other DBs
NCBI-GeneID: 1238054
NCBI-ProteinID: NP_858260
UniProt: P18012
LinkDB
Position
pCP301:complement(110137..111228)
AA seq 363 aa
MEIQNTKPTQILYTDISTKQTQSSSETQKSQNYQQIAAHIPLNVGKNPVLTTTLNDDQLL
KLSEQVQHDSEIIARLTDKKMKDRSEMSHTLTPENTLDISSLSSNAVSLIISVAVLLSAL
RTAETKLGSQLSLIAFDATKSAAENIVRQGLAALSSSITGAVTQVGITGIGAKKTHSGIS
DQKGALRKNLATAQSLEKELAGSKLGLNKQIDTNITSPQTNSSTKFLGKNKLAPDNISLS
TEHKTSLSSPDISLQDKIDTQRRTYELNTLSAQQKQNIGRATMETSAVAGNISTSGGRYA
SALEEEEQLISQASSKQAEEASQVSKEASQATNQLIQKLLNIIDSINQSKNSTASQIAGN
IRA
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggaaattcaaaacacaaaaccaacccagattttatatacagatatatccacaaaacaa
actcaaagttcttccgaaacacaaaaatcacaaaattatcagcagattgcagcgcatatt
ccacttaatgtcggtaaaaatcccgtattaacaaccacattaaatgatgatcaactttta
aagttatcagagcaggttcagcatgattcagaaatcattgctcgccttactgacaaaaag
atgaaagatcgttcagagatgagtcacacccttactccagagaacactctggatatttcc
agtctttcttctaatgctgtttctttaattattagtgtagccgttctactttctgctctc
cgcactgcagaaactaaattgggctctcaattgtcattgattgcgttcgatgctacaaaa
tcagctgcagagaacattgttcggcaaggcctggcagccctatcatcaagcattactgga
gcagtcacacaagtaggtataacgggtatcggtgccaaaaaaacgcattcagggattagc
gaccaaaaaggagccttaagaaagaaccttgccactgctcaatctcttgaaaaagagctt
gcaggttctaaattagggttaaataaacaaatagatacaaatatcacctcaccacaaact
aactctagcacaaaatttttaggtaaaaataaactggcgccagataatatatccctgtca
actgaacataaaacttctcttagttctcccgatatttctttgcaggataaaattgacacc
cagagaagaacttacgagctcaataccctttctgcgcagcaaaaacaaaacattggccgt
gcaacaatggaaacatcagccgttgctggtaatatatccacatcaggagggcgttatgca
tctgctcttgaagaagaagaacaactaatcagtcaggccagcagtaaacaagcagaggaa
gcatcccaagtatctaaagaagcatcccaagcgacaaatcaattaatacaaaaattattg
aatataattgacagcatcaaccaatcaaagaattcgacagccagtcagattgctggtaac
attcgagcttaa

DBGET integrated database retrieval system