KEGG   Shigella flexneri 301 (serotype 2a): CP0128
Entry
CP0128            CDS       T00097                                 
Symbol
ipaB
Name
(RefSeq) IpaB, secreted by the Mxi-Spa secretion machinery, required for entry into epithelial cells
  KO
K13285  invasin B
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
sfl05100  Bacterial invasion of epithelial cells
sfl05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:sfl00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    CP0128 (ipaB)
   05100 Bacterial invasion of epithelial cells
    CP0128 (ipaB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfl02000]
    CP0128 (ipaB)
Transporters [BR:sfl02000]
 Other transporters
  Pores ion channels [TC:1]
   CP0128 (ipaB)
SSDB
Motif
Pfam: SseC T3SSipB KH_4 MRPL52 Yuri_gagarin DUF3040
Other DBs
NCBI-GeneID: 1238055
NCBI-ProteinID: NP_858261
UniProt: P18011
Structure
LinkDB
Position
pCP301:complement(111248..112990)
AA seq 580 aa
MHNVSTTTTGFPLAKILASTELGDNTIQAANDAANKLFSLTIADLTANQNINTTNAHSTS
NILIPELKAPKSLNASSQLTLLIGNLIQILGEKSLTALTNKITAWKSQQQARQQKNLEFS
DKINTLLSETEGLTRDYEKQINKLKNADSKIKDLENKINQIQTRLSELDPESPEKKKLSR
EEIQLTIKKDAAVKDRTLIEQKTLSIHSKLTDKSMQLEKEIDSFSAFSNTASAEQLSTQQ
KSLTGLASVTQLMATFIQLVGKNNEESLKNDLALFQSLQESRKTEMERKSDEYAAEVRKA
EELNRVMGCVGKILGALLTIVSVVAAAFSGGASLALAAVGLALMVTDAIVQAATGNSFME
QALNPIMKAVIEPLIKLLSDAFTKMLEGLGVDSKKAKMIGSILGAIAGALVLVAAVVLVA
TVGKQAAAKLAENIGKIIGKTLTDLIPKFLKNFSSQLDDLITNAVARLNKFLGAAGDEVI
SKQIISTHLNQAVLLGESVNSATQAGGSVASAVFQNSASTNLADLTLSKYQVEQLSKYIS
EAIEKFGQLQEVIADLLASMSNSQANRTDVAKAILQQTTA
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgcataatgtaagcaccacaaccactggttttcctcttgccaaaatattggcttccact
gagcttggagacaatactatccaagctgcaaatgatgcagctaacaaattattttctctt
acaattgctgatcttactgctaaccaaaatattaatacaactaatgcacactcaacttca
aatatattaatccctgaacttaaagcaccaaagtcattaaatgcaagttcccaactaacg
cttttaattggaaaccttattcaaatactcggtgaaaaatctttaactgcattaacaaat
aaaattactgcttggaagtcccagcaacaggcaagacagcaaaaaaacctagaattctcc
gataaaattaacactcttctatctgaaactgaaggactaaccagagactatgaaaaacaa
attaataaactaaaaaacgcagattctaaaataaaagacctagaaaataaaattaaccaa
attcaaacaagattatccgaactcgacccagagtcaccagaaaagaaaaaattaagccgg
gaagaaatacaactcactatcaaaaaagacgcagcagttaaagacaggacattgattgag
cagaaaaccctgtcaattcatagcaaacttacagataaatcaatgcaactcgaaaaagaa
atagactctttttctgcattttcaaacacagcatctgctgaacagctatcaacccagcag
aaatcattaaccggacttgccagtgttactcaattgatggcaacctttattcaactagtt
ggaaaaaataatgaagaatctttaaaaaatgatctggctctattccagtctctccaagaa
tcaagaaaaactgaaatggagagaaaatctgatgagtatgctgctgaagtacgtaaagca
gaagaactcaacagagtaatgggttgtgttgggaaaatacttggggcacttttaactatc
gttagtgttgttgcagcagctttttctggaggagcctctctagcactggcagctgttggt
ttagctcttatggttacggatgctatagtacaagcagcgaccggcaattccttcatggaa
caagccctgaatccgatcatgaaagcagtcattgaacccttaatcaaactcctttcagat
gcatttacaaaaatgctcgaaggcttgggcgtcgactcgaaaaaagccaaaatgattggc
tctattctgggggcaatcgcaggcgctcttgtcctagttgcagcagtcgttctcgtagcc
actgttggtaaacaggcagcagcaaaacttgcagaaaatattggcaaaataataggtaaa
accctcacagaccttataccaaagtttctcaagaatttttcttctcaactggacgattta
atcactaatgctgttgccagattaaataaatttcttggtgcagcgggtgatgaagtaata
tccaaacaaattatttccacccatttaaaccaagcagttttattaggagaaagtgttaac
tctgccacacaagcgggaggaagtgtcgcttctgctgttttccagaacagcgcgtcgaca
aatctagcagacctgacattatcgaaatatcaagttgaacaactgtcaaaatatatcagt
gaagcaatagaaaaattcggccaattgcaggaagtaattgcagatctattagcctcaatg
tccaactctcaggctaatagaactgatgttgcaaaagcaattttgcaacaaactactgct
tga

DBGET integrated database retrieval system