Shigella flexneri 301 (serotype 2a): SF1077 Help Entry SF1077            CDS       T00097                                  Symbol flgM Name (RefSeq) anti-sigma28 factor FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism sfl  Shigella flexneri 301 (serotype 2a) Pathway sfl02020   Two-component system sfl02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:sfl00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     SF1077 (flgM)  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     SF1077 (flgM)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:sfl02035]     SF1077 (flgM) Bacterial motility proteins [BR:sfl02035]  Flagellar system   Flagellar assembly proteins    Others     SF1077 (flgM) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-GeneID:  1024006 NCBI-ProteinID:  NP_706992 UniProt:  P0AEM5 A0AB36PE60 LinkDB All DBs Position complement(1117596..1117889) Genome browser AA seq 97 aa AA seqDB search MSIDRTSPLKPVSTVQPRETTDAPVTNSRAAKTTASTSTSVTLSDAQAKLMQPGSSDINL ERVEALKLAIRNGELKMDTGKIADALINEAQQDLQSN NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgagtattgatcgcacttcgcctctgaagcctgtaagcaccgttcaaccgcgcgaaacc accgacgcgccggtaacgaacagccgggcggcaaaaacaaccgcctccaccagcaccagt gtgacgttaagcgacgcgcaagcaaaactgatgcaacccggcagcagtgatatcaatctt gaacgtgtcgaagcgttaaaactggcgattcgtaacggtgaactaaaaatggacaccggc aaaattgccgatgcgctgatcaacgaagcgcagcaagacttgcagagtaactga

DBGET integrated database retrieval system