KEGG   Shigella flexneri 301 (serotype 2a): SF1685
Entry
SF1685            CDS       T00097                                 
Name
(RefSeq) transporter
  KO
K19577  MFS transporter, DHA1 family, inner membrane transport protein
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Brite
KEGG Orthology (KO) [BR:sfl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfl02000]
    SF1685
Transporters [BR:sfl02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    SF1685
SSDB
Motif
Pfam: MFS_1 MFS_4 Sugar_tr
Other DBs
NCBI-GeneID: 1024847
NCBI-ProteinID: NP_707557
UniProt: A0A0H2UZQ6 A0AB36PAM2
LinkDB
Position
complement(1715810..1716979)
AA seq 389 aa
MKINYPLLALAIGAFGIGTTEFSPMGLLPVIARGVDVSIPAAGMLISAYAVGVMVGAPLM
TLLLSHRARRSALIFLMAIFTLGNVLSAIAPDYMTLMLSRILTSLNHGAFFGLGSVVAAS
VVPKHKQASAVATMFMGLTLANIGGVPAATWLGETIGWRMSFLATAGLGVISMVSLFFSL
PKGGTGARPEVKKELAVLMRPQVLSALLTTVLGAGAMFTLYTYISPVLQSITHATPVFVT
AMLVLIGVGFSIGNYLGGKLADRSVNGTLKGFLLLLMVIMLAIPFLARNEFGAAISMVVW
GAATFAVVPPLQMRVMHVASEAPGLSSSVNIGAFNLGNALGAAAGGAVISAGLGYSFVPV
TGAIVAGLALLLVFMSARKQPETVCVANS
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgaaaattaactatccgttgctggcgctggcgattggcgcgtttggtatcgggacaacg
gagttctcgccaatgggcttgttgcccgtcattgcgcgcggtgtggatgtctcgattccc
gctgccggaatgttaatcagtgcctatgcagttggcgtaatggtgggcgcgccgctgatg
acgcttctactttctcatcgtgcccgccgcagtgcgttgattttcctgatggcaattttc
acgctaggcaacgttctttccgccatcgcgccggattatatgaccctgatgctttcacgt
attttgaccagcctgaatcacggagcattttttggtttgggttcagtcgtggccgcaagc
gtggtgccaaaacataaacaggccagcgcagttgccactatgtttatggggttaaccctg
gcaaatatcggtggcgtgccggcggcgacctggttgggtgaaaccatcggctggcggatg
tcatttctggcaacggcggggctgggagtgatttcaatggtaagtctgttcttctcatta
cctaaaggtggtacaggggcacgacctgaagtgaaaaaagagctggcggtattaatgcgt
ccgcaggtgctgtctgcattgctgacgacggtactgggagctggtgcaatgtttaccctc
tacacctatatctctccggtactgcaaagtattacccacgcaacaccggtgttcgtcacg
gcaatgctggtgctgattggtgtcggattctctatcggtaactatctcggcggcaaactg
gcagatcgttcagttaacggcacgttgaaaggctttttgttgctgctgatggtgattatg
ctggcaatcccgttcctggcccgcaatgagttcggcgcagctattagcatggtggtgtgg
ggcgcagcaacctttgcggttgtacctccgttacagatgcgcgtgatgcatgtcgccagt
gaagcgccaggtctgtcttcatcagtcaatattggtgcctttaatcttggaaatgcgctg
ggagcagctgctggtggtgcggtaatttccgctgggctgggatacagctttgtgccggtg
acgggggcgattgtcgcgggactggcattattgctggtgtttatgtcagccagaaaacaa
cctgaaacagtttgcgttgctaacagctaa

DBGET integrated database retrieval system