Shigella flexneri 301 (serotype 2a): SF1879 Help Entry SF1879            CDS       T00097                                  Name (RefSeq) bacteriophage protein   KO K12149   DNA-damage-inducible protein I Organism sfl  Shigella flexneri 301 (serotype 2a) Brite KEGG Orthology (KO) [BR:sfl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:sfl03400]     SF1879 DNA repair and recombination proteins [BR:sfl03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     SF1879 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI MAPKK1_Int MinE Motif Other DBs NCBI-GeneID:  1026504 NCBI-ProteinID:  NP_707727 UniProt:  A0A0H2UZZ8 A0AB36PAK7 LinkDB All DBs Position 1917074..1917322 Genome browser AA seq 82 aa AA seqDB search MRFEICIAKEKMTKMPTGAVDALKEELTRRISKRYDDVEVIVKATSNDGLSVTRTADKDS AKTFVQETLKDTWESADEWFVH NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcgttttgaaatctgcatagccaaagagaaaatgactaaaatgccaaccggtgctgtg gatgcgttaaaggaagaattaacccgacgcatcagtaaacgttatgacgatgtagaggtg atcgtaaaagccaccagcaacgatggcctttctgttacgcgcaccgccgataaagattca gctaaaacttttgttcaggaaactctgaaagatacctgggagtctgctgacgagtggttt gttcactaa

DBGET integrated database retrieval system